Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SREBF1 Rabbit pAb (A15586)

Publications (32) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - SREBF1 Rabbit pAb (A15586)

Western blot analysis of lysates from Rat liver using SREBF1 Rabbit pAb(A15586) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - SREBF1 Rabbit pAb (A15586)

Immunofluorescence analysis of C6 cells using SREBF1 Rabbit pAb (A15586) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name SREBF1 Rabbit pAb
Catalog No. A15586
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a basic helix-loop-helix-leucine zipper (bHLH-Zip) transcription factor that binds to the sterol regulatory element-1 (SRE1), which is a motif that is found in the promoter of the low density lipoprotein receptor gene and other genes involved in sterol biosynthesis. The encoded protein is synthesized as a precursor that is initially attached to the nuclear membrane and endoplasmic reticulum. Following cleavage, the mature protein translocates to the nucleus and activates transcription. This cleaveage is inhibited by sterols. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative promoter usage and splicing result in multiple transcript variants, including SREBP-1a and SREBP-1c, which correspond to RefSeq transcript variants 2 and 3, respectively.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-310 of human SREBF1 (NP_004167.3).
Sequence SLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAA
Gene ID 6720
Swiss prot P36956
Synonyms HMD; IFAP2; SREBP1; bHLHd1; SREBF1
Calculated MW 122kDa
Observed MW 68kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Rat liver
Cellular location COPII-coated vesicle membrane, Cytoplasmic vesicle, Endoplasmic reticulum membrane, Golgi apparatus membrane, Multi-pass membrane protein, Multi-pass membrane protein, Nucleus
Customer validation

WB (Mus musculus, Sus scrofa, Gallus gallus, Homo sapiens, Rattus norvegicus, Mesocricetus auratus, Oryctolagus cuniculus, Spondyliosoma cantharus)

RT-PCR (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SREBF1 Rabbit pAb images

ABclonal:Western blot - SREBF1 Rabbit pAb (A15586)}

Western blot - SREBF1 Rabbit pAb (A15586)

Western blot analysis of lysates from Rat liver using SREBF1 Rabbit pAb(A15586) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunofluorescence - SREBF1 Rabbit pAb (A15586)}

Immunofluorescence - SREBF1 Rabbit pAb (A15586)

Immunofluorescence analysis of C6 cells using SREBF1 Rabbit pAb (A15586) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A15586 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SREBF1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SREBF1. (Distance between topics and target gene indicate popularity.) SREBF1

* Data provided by citexs.com, for reference only.

Publishing research using A15586? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order