Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Src Rabbit pAb (A11707)

Publications (2) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Src Rabbit pAb (A11707)

Western blot analysis of various lysates using Src Rabbit pAb (A11707) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - Src Rabbit pAb (A11707)

Immunohistochemistry analysis of Src in paraffin-embedded human lung cancer using Src Rabbit pAb (A11707) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Src Rabbit pAb (A11707)

Immunohistochemistry analysis of Src in paraffin-embedded human breast cancer using Src Rabbit pAb (A11707) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Src Rabbit pAb (A11707)

Immunohistochemistry analysis of Src in paraffin-embedded human placenta using Src Rabbit pAb (A11707) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Src Rabbit pAb (A11707)

Immunohistochemistry analysis of Src in paraffin-embedded human gastric cancer using Src Rabbit pAb (A11707) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Src Rabbit pAb (A11707)

Immunofluorescence analysis of C6 cells using Src Rabbit pAb (A11707) at dilution of 1:100. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Src Rabbit pAb (A11707)

Immunofluorescence analysis of NIH/3T3 cells using Src Rabbit pAb (A11707) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Src Rabbit pAb
Catalog No. A11707
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human Src (NP_005408.1).
Sequence MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAG
Gene ID 6714
Swiss prot P12931
Synonyms ASV; SRC1; THC6; c-SRC; p60-Src; Src
Calculated MW 60kDa
Observed MW 60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Jurkat, SH-SY5Y
Cellular location Cell membrane, Cytoplasm, Mitochondrion inner membrane, Nucleus, cytoskeleton
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Src Rabbit pAb images

ABclonal:Western blot - Src Rabbit pAb (A11707)}

Western blot - Src Rabbit pAb (A11707)

Western blot analysis of various lysates using Src Rabbit pAb (A11707) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Immunohistochemistry - Src Rabbit pAb (A11707)}

Immunohistochemistry - Src Rabbit pAb (A11707)

Immunohistochemistry analysis of Src in paraffin-embedded human lung cancer using Src Rabbit pAb (A11707) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Src Rabbit pAb (A11707)}

Immunohistochemistry - Src Rabbit pAb (A11707)

Immunohistochemistry analysis of Src in paraffin-embedded human breast cancer using Src Rabbit pAb (A11707) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Src Rabbit pAb (A11707)}

Immunohistochemistry - Src Rabbit pAb (A11707)

Immunohistochemistry analysis of Src in paraffin-embedded human placenta using Src Rabbit pAb (A11707) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Src Rabbit pAb (A11707)}

Immunohistochemistry - Src Rabbit pAb (A11707)

Immunohistochemistry analysis of Src in paraffin-embedded human gastric cancer using Src Rabbit pAb (A11707) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Src Rabbit pAb (A11707)}

Immunofluorescence - Src Rabbit pAb (A11707)

Immunofluorescence analysis of C6 cells using Src Rabbit pAb (A11707) at dilution of 1:100. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Src Rabbit pAb (A11707)}

Immunofluorescence - Src Rabbit pAb (A11707)

Immunofluorescence analysis of NIH/3T3 cells using Src Rabbit pAb (A11707) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A11707 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SRC. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SRC. (Distance between topics and target gene indicate popularity.) SRC

* Data provided by citexs.com, for reference only.

Publishing research using A11707? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order