Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

alpha 1 Spectrin Rabbit pAb (A12355)

Publications (2) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - alpha 1 Spectrin Rabbit pAb (A12355)

Western blot analysis of various lysates using alpha 1 Spectrin Rabbit pAb (A12355) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - alpha 1 Spectrin Rabbit pAb (A12355)

Immunohistochemistry analysis of alpha 1 Spectrin in paraffin-embedded human tonsil using alpha 1 Spectrin Rabbit pAb (A12355) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - alpha 1 Spectrin Rabbit pAb (A12355)

Immunohistochemistry analysis of alpha 1 Spectrin in paraffin-embedded rat spleen using alpha 1 Spectrin Rabbit pAb (A12355) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - alpha 1 Spectrin Rabbit pAb (A12355)

Immunohistochemistry analysis of alpha 1 Spectrin in paraffin-embedded mouse liver using alpha 1 Spectrin Rabbit pAb (A12355) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - alpha 1 Spectrin Rabbit pAb (A12355)

Immunofluorescence analysis of paraffin-embedded rat bone marrow using alpha 1 Spectrin Rabbit pAb (A12355) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - alpha 1 Spectrin Rabbit pAb (A12355)

Immunofluorescence analysis of paraffin-embedded mouse lung using alpha 1 Spectrin Rabbit pAb (A12355) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name alpha 1 Spectrin Rabbit pAb
Catalog No. A12355
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of a family of molecular scaffold proteins that link the plasma membrane to the actin cytoskeleton and functions in the determination of cell shape, arrangement of transmembrane proteins, and organization of organelles. The encoded protein is primarily composed of 22 spectrin repeats which are involved in dimer formation. It forms a component of the erythrocyte plasma membrane. Mutations in this gene result in a variety of hereditary red blood cell disorders, including elliptocytosis-2, pyropoikilocytosis, and spherocytosis, type 3.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 940-1160 of human alpha 1 Spectrin (NP_003117.2).
Sequence KHEAFLLDLNSFGDSMKALRNQANACQQQQAAPVEGVAGEQRVMALYDFQARSPREVTMKKGDVLTLLSSINKDWWKVEAADHQGIVPAVYVRRLAHDEFPMLPQRRREEPGNITQRQEQIENQYRSLLDRAEERRRRLLQRYNEFLLAYEAGDMLEWIQEKKAENTGVELDDVWELQKKFDEFQKDLNTNEPRLRDINKVADDLLFEGLLTPEGAQIRQE
Gene ID 6708
Swiss prot P02549
Synonyms EL2; HPP; HS3; SPH3; SPTA; alpha 1 Spectrin
Calculated MW 280kDa
Observed MW 300kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples 239T, LO2, A-549, Mouse kidney, Mouse liver, Mouse lung, Rat heart
Cellular location Cytoplasm, cell cortex, cytoskeleton
Customer validation

IP (Mus musculus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

alpha 1 Spectrin Rabbit pAb images

ABclonal:Western blot - alpha 1 Spectrin Rabbit pAb (A12355)}

Western blot - alpha 1 Spectrin Rabbit pAb (A12355)

Western blot analysis of various lysates using alpha 1 Spectrin Rabbit pAb (A12355) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - alpha 1 Spectrin Rabbit pAb (A12355)}

Immunohistochemistry - alpha 1 Spectrin Rabbit pAb (A12355)

Immunohistochemistry analysis of alpha 1 Spectrin in paraffin-embedded human tonsil using alpha 1 Spectrin Rabbit pAb (A12355) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - alpha 1 Spectrin Rabbit pAb (A12355)}

Immunohistochemistry - alpha 1 Spectrin Rabbit pAb (A12355)

Immunohistochemistry analysis of alpha 1 Spectrin in paraffin-embedded rat spleen using alpha 1 Spectrin Rabbit pAb (A12355) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - alpha 1 Spectrin Rabbit pAb (A12355)}

Immunohistochemistry - alpha 1 Spectrin Rabbit pAb (A12355)

Immunohistochemistry analysis of alpha 1 Spectrin in paraffin-embedded mouse liver using alpha 1 Spectrin Rabbit pAb (A12355) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - alpha 1 Spectrin Rabbit pAb (A12355)}

Immunofluorescence - alpha 1 Spectrin Rabbit pAb (A12355)

Immunofluorescence analysis of paraffin-embedded rat bone marrow using alpha 1 Spectrin Rabbit pAb (A12355) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - alpha 1 Spectrin Rabbit pAb (A12355)}

Immunofluorescence - alpha 1 Spectrin Rabbit pAb (A12355)

Immunofluorescence analysis of paraffin-embedded mouse lung using alpha 1 Spectrin Rabbit pAb (A12355) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A12355 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SPTA1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SPTA1. (Distance between topics and target gene indicate popularity.) SPTA1

* Data provided by citexs.com, for reference only.

Publishing research using A12355? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order