Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SNRPD1 Rabbit pAb (A14493)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - SNRPD1 Rabbit pAb (A14493)

Western blot analysis of extracts of various cell lines, using SNRPD1 antibody (A14493) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - SNRPD1 Rabbit pAb (A14493)

Immunohistochemistry analysis of paraffin-embedded human breast cancer using SNRPD1 Rabbit pAb (A14493) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - SNRPD1 Rabbit pAb (A14493)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using SNRPD1 Rabbit pAb (A14493) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - SNRPD1 Rabbit pAb (A14493)

Immunohistochemistry analysis of paraffin-embedded rat kidney using SNRPD1 Rabbit pAb (A14493) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - SNRPD1 Rabbit pAb (A14493)

Immunofluorescence analysis of HeLa cells using SNRPD1 Rabbit pAb (A14493) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - SNRPD1 Rabbit pAb (A14493)

Immunofluorescence analysis of U2OS cells using SNRPD1 Rabbit pAb (A14493) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name SNRPD1 Rabbit pAb
Catalog No. A14493
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a small nuclear ribonucleoprotein that belongs to the SNRNP core protein family. The protein may act as a charged protein scaffold to promote SNRNP assembly or strengthen SNRNP-SNRNP interactions through nonspecific electrostatic contacts with RNA. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-96 of human SNRPD1 (NP_008869.1).
Sequence MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVA
Gene ID 6632
Swiss prot P62314
Synonyms SMD1; SNRPD; Sm-D1; HsT2456; SNRPD1
Calculated MW 13kDa
Observed MW 13kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, 293T, K-562, Mouse brain, Mouse spleen, Rat brain, Rat thymus
Cellular location Cytoplasm, Nucleus, cytosol

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SNRPD1 Rabbit pAb images

ABclonal:Western blot - SNRPD1 Rabbit pAb (A14493)}

Western blot - SNRPD1 Rabbit pAb (A14493)

Western blot analysis of extracts of various cell lines, using SNRPD1 antibody (A14493) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - SNRPD1 Rabbit pAb (A14493)}

Immunohistochemistry - SNRPD1 Rabbit pAb (A14493)

Immunohistochemistry analysis of paraffin-embedded human breast cancer using SNRPD1 Rabbit pAb (A14493) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - SNRPD1 Rabbit pAb (A14493)}

Immunohistochemistry - SNRPD1 Rabbit pAb (A14493)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using SNRPD1 Rabbit pAb (A14493) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - SNRPD1 Rabbit pAb (A14493)}

Immunohistochemistry - SNRPD1 Rabbit pAb (A14493)

Immunohistochemistry analysis of paraffin-embedded rat kidney using SNRPD1 Rabbit pAb (A14493) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - SNRPD1 Rabbit pAb (A14493)}

Immunofluorescence - SNRPD1 Rabbit pAb (A14493)

Immunofluorescence analysis of HeLa cells using SNRPD1 Rabbit pAb (A14493) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - SNRPD1 Rabbit pAb (A14493)}

Immunofluorescence - SNRPD1 Rabbit pAb (A14493)

Immunofluorescence analysis of U2OS cells using SNRPD1 Rabbit pAb (A14493) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A14493 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SNRPD1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SNRPD1. (Distance between topics and target gene indicate popularity.) SNRPD1

* Data provided by citexs.com, for reference only.

Publishing research using A14493? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order