Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SMYD3 Rabbit pAb (A14516)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - SMYD3 Rabbit pAb (A14516)

Western blot analysis of various lysates using SMYD3 Rabbit pAb (A14516) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - SMYD3 Rabbit pAb (A14516)

Immunohistochemistry analysis of SMYD3 in paraffin-embedded Human colon using SMYD3 Rabbit pAb (A14516) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - SMYD3 Rabbit pAb (A14516)

Immunofluorescence analysis of C6 cells using SMYD3 Rabbit pAb (A14516) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - SMYD3 Rabbit pAb (A14516)

Immunofluorescence analysis of HeLa cells using SMYD3 Rabbit pAb (A14516) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - SMYD3 Rabbit pAb (A14516)

Immunofluorescence analysis of L929 cells using SMYD3 Rabbit pAb (A14516) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name SMYD3 Rabbit pAb
Catalog No. A14516
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a histone methyltransferase which functions in RNA polymerase II complexes by an interaction with a specific RNA helicase. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SMYD3 (NP_001161212.1).
Sequence DRCLLGKEKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGLRQLVMT
Gene ID 64754
Swiss prot Q9H7B4
Synonyms KMT3E; ZMYND1; ZNFN3A1; bA74P14.1; SMYD3
Calculated MW 49kDa
Observed MW 49kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples 22Rv1, HT-29, HepG2, MCF7, HeLa, Mouse testis
Cellular location Cytoplasm, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SMYD3 Rabbit pAb images

ABclonal:Western blot - SMYD3 Rabbit pAb (A14516)}

Western blot - SMYD3 Rabbit pAb (A14516)

Western blot analysis of various lysates using SMYD3 Rabbit pAb (A14516) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - SMYD3 Rabbit pAb (A14516)}

Immunohistochemistry - SMYD3 Rabbit pAb (A14516)

Immunohistochemistry analysis of SMYD3 in paraffin-embedded Human colon using SMYD3 Rabbit pAb (A14516) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - SMYD3 Rabbit pAb (A14516)}

Immunofluorescence - SMYD3 Rabbit pAb (A14516)

Immunofluorescence analysis of C6 cells using SMYD3 Rabbit pAb (A14516) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - SMYD3 Rabbit pAb (A14516)}

Immunofluorescence - SMYD3 Rabbit pAb (A14516)

Immunofluorescence analysis of HeLa cells using SMYD3 Rabbit pAb (A14516) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - SMYD3 Rabbit pAb (A14516)}

Immunofluorescence - SMYD3 Rabbit pAb (A14516)

Immunofluorescence analysis of L929 cells using SMYD3 Rabbit pAb (A14516) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A14516 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SMYD3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SMYD3. (Distance between topics and target gene indicate popularity.) SMYD3

* Data provided by citexs.com, for reference only.

Publishing research using A14516? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order