Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Smad4 Rabbit pAb (A5657)

Reviews (3) Publications (8) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Immunohistochemistry - Smad4 Rabbit pAb (A5657)

Immunohistochemistry analysis of Smad4 in paraffin-embedded rat kidney using Smad4 Rabbit pAb (A5657) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Smad4 Rabbit pAb (A5657)

Immunohistochemistry analysis of Smad4 in paraffin-embedded human colon using Smad4 Rabbit pAb (A5657) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Smad4 Rabbit pAb (A5657)

Immunohistochemistry analysis of Smad4 in paraffin-embedded mouse kidney using Smad4 Rabbit pAb (A5657) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Smad4 Rabbit pAb (A5657)

Immunofluorescence analysis of C6 cells using Smad4 Rabbit pAb (A5657) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Smad4 Rabbit pAb (A5657)

Immunofluorescence analysis of HeLa cells using Smad4 Rabbit pAb (A5657) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Smad4 Rabbit pAb (A5657)

Immunofluorescence analysis of HepG2 cells using Smad4 Rabbit pAb (A5657) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Smad4 Rabbit pAb (A5657)

Immunofluorescence analysis of NIH/3T3 cells using Smad4 Rabbit pAb (A5657) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for Smad4 Rabbit pAb(A5657)
Review
ABclonal: review for Smad4 Rabbit pAb(A5657)
Review
ABclonal: review for Smad4 Rabbit pAb(A5657)

You may also interested in:

Overview

Product name Smad4 Rabbit pAb
Catalog No. A5657
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the Smad family of signal transduction proteins. Smad proteins are phosphorylated and activated by transmembrane serine-threonine receptor kinases in response to transforming growth factor (TGF)-beta signaling. The product of this gene forms homomeric complexes and heteromeric complexes with other activated Smad proteins, which then accumulate in the nucleus and regulate the transcription of target genes. This protein binds to DNA and recognizes an 8-bp palindromic sequence (GTCTAGAC) called the Smad-binding element (SBE). The protein acts as a tumor suppressor and inhibits epithelial cell proliferation. It may also have an inhibitory effect on tumors by reducing angiogenesis and increasing blood vessel hyperpermeability. The encoded protein is a crucial component of the bone morphogenetic protein signaling pathway. The Smad proteins are subject to complex regulation by post-translational modifications. Mutations or deletions in this gene have been shown to result in pancreatic cancer, juvenile polyposis syndrome, and hereditary hemorrhagic telangiectasia syndrome.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 320-552 of human Smad4 (NP_005350.1).
Sequence PEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD
Gene ID 4089
Swiss prot Q13485
Synonyms JIP; DPC4; MADH4; MYHRS; Smad4
Calculated MW 60kDa
Observed MW 63kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, SKOV3, A673, 293T, HepG2
Cellular location Cytoplasm, Nucleus
Customer validation

WB (mouse cells, HEK293TMus musculus, Homo sapiens, Mus musculus)

IF (SW480Homo sapiens)

Co-IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Smad4 Rabbit pAb images

ABclonal:Immunohistochemistry - Smad4 Rabbit pAb (A5657)}

Immunohistochemistry - Smad4 Rabbit pAb (A5657)

Immunohistochemistry analysis of Smad4 in paraffin-embedded rat kidney using Smad4 Rabbit pAb (A5657) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Smad4 Rabbit pAb (A5657)}

Immunohistochemistry - Smad4 Rabbit pAb (A5657)

Immunohistochemistry analysis of Smad4 in paraffin-embedded human colon using Smad4 Rabbit pAb (A5657) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Smad4 Rabbit pAb (A5657)}

Immunohistochemistry - Smad4 Rabbit pAb (A5657)

Immunohistochemistry analysis of Smad4 in paraffin-embedded mouse kidney using Smad4 Rabbit pAb (A5657) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Smad4 Rabbit pAb (A5657)}

Immunofluorescence - Smad4 Rabbit pAb (A5657)

Immunofluorescence analysis of C6 cells using Smad4 Rabbit pAb (A5657) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Smad4 Rabbit pAb (A5657)}

Immunofluorescence - Smad4 Rabbit pAb (A5657)

Immunofluorescence analysis of HeLa cells using Smad4 Rabbit pAb (A5657) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Smad4 Rabbit pAb (A5657)}

Immunofluorescence - Smad4 Rabbit pAb (A5657)

Immunofluorescence analysis of HepG2 cells using Smad4 Rabbit pAb (A5657) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Smad4 Rabbit pAb (A5657)}

Immunofluorescence - Smad4 Rabbit pAb (A5657)

Immunofluorescence analysis of NIH/3T3 cells using Smad4 Rabbit pAb (A5657) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A5657

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A5657 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SMAD4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SMAD4. (Distance between topics and target gene indicate popularity.) SMAD4

* Data provided by citexs.com, for reference only.

Publishing research using A5657? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order