Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Smad3 Rabbit pAb (A16913)

Publications (15) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Smad3 Rabbit pAb (A16913)

Western blot analysis of various lysates using (A16913) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - Smad3 Rabbit pAb (A16913)

Immunofluorescence analysis of NIH/3T3 cells using Smad3 Rabbit pAb (A16913) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Smad3 Rabbit pAb
Catalog No. A16913
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The SMAD family of proteins are a group of intracellular signal transducer proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. The SMAD3 protein functions in the transforming growth factor-beta signaling pathway, and transmits signals from the cell surface to the nucleus, regulating gene activity and cell proliferation. This protein forms a complex with other SMAD proteins and binds DNA, functioning both as a transcription factor and tumor suppressor. Mutations in this gene are associated with aneurysms-osteoarthritis syndrome and Loeys-Dietz Syndrome 3.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 150-250 of human Smad3 (NP_005893.1).
Sequence FPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHA
Gene ID 4088
Swiss prot P84022
Synonyms LDS3; mad3; LDS1C; MADH3; JV15-2; hMAD-3; hSMAD3; HSPC193; HsT17436; Smad3
Calculated MW 48kDa
Observed MW 52kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples A-431, HT-1080, C2C12, 293T, Mouse ovary, Mouse brain, Rat brain
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Homo sapiens, Dendrobium officinale Kimura et Migo, Rattus norvegicus, Capra hircus, Mus musculus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Smad3 Rabbit pAb images

ABclonal:Western blot - Smad3 Rabbit pAb (A16913)}

Western blot - Smad3 Rabbit pAb (A16913)

Western blot analysis of various lysates using (A16913) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - Smad3 Rabbit pAb (A16913)}

Immunofluorescence - Smad3 Rabbit pAb (A16913)

Immunofluorescence analysis of NIH/3T3 cells using Smad3 Rabbit pAb (A16913) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A16913 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SMAD3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SMAD3. (Distance between topics and target gene indicate popularity.) SMAD3

* Data provided by citexs.com, for reference only.

Publishing research using A16913? Please let us know so that we can cite the reference in this datasheet.

Antibodies (8)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order