Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SLCO2B1 Rabbit pAb (A10073)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - SLCO2B1 Rabbit pAb (A10073)

Western blot analysis of extracts of various cell lines, using SLCO2B1 antibody (A10073) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 8s.

You may also interested in:

Overview

Product name SLCO2B1 Rabbit pAb
Catalog No. A10073
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This locus encodes a member of the organic anion-transporting polypeptide family of membrane proteins. The protein encoded by this locus may function in regulation of placental uptake of sulfated steroids. Alternatively spliced transcript variants have been described.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 130-210 of human SLCO2B1 (NP_009187.1).
Sequence LLMTLPHFISEPYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSYTETQHLSVVGIMFVAQTLLGVGGVPIQPFG
Gene ID 11309
Swiss prot O94956
Synonyms OATPB; OATP-B; OATP2B1; SLC21A9; SLCO2B1
Calculated MW 77kDa
Observed MW 76kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HepG2, Mouse liver
Cellular location Cell membrane, Multi-pass membrane protein

Research Area

SLCO2B1 Rabbit pAb images

ABclonal:Western blot - SLCO2B1 Rabbit pAb (A10073)}

Western blot - SLCO2B1 Rabbit pAb (A10073)

Western blot analysis of extracts of various cell lines, using SLCO2B1 antibody (A10073) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 8s.

Inquire About This Product

Submit your question about A10073 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SLCO2B1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SLCO2B1. (Distance between topics and target gene indicate popularity.) SLCO2B1

* Data provided by citexs.com, for reference only.

Publishing research using A10073? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order