Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

LAT1/SLC7A5 Rabbit pAb (A2833)

Review (1) Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - LAT1/SLC7A5 Rabbit pAb (A2833)

Western blot analysis of Mouse testis, using LAT1/SLC7A5 antibody (A2833) at 1:900 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - LAT1/SLC7A5 Rabbit pAb (A2833)

Immunofluorescence analysis of MCF7 cells using LAT1/SLC7A5 Rabbit pAb (A2833) at dilution of 1:300 (40x lens). Blue: DAPI for nuclear staining.

Review
ABclonal: review for LAT1/SLC7A5 Rabbit pAb(A2833)

You may also interested in:

Overview

Product name LAT1/SLC7A5 Rabbit pAb
Catalog No. A2833
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables L-leucine transmembrane transporter activity; L-tryptophan transmembrane transporter activity; and thyroid hormone transmembrane transporter activity. Involved in carboxylic acid transport; thyroid hormone transport; and xenobiotic transport. Located in cytosol; intracellular membrane-bounded organelle; and plasma membrane. Is integral component of membrane. Part of amino acid transport complex; apical plasma membrane; and microvillus membrane.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human LAT1/SLC7A5 (NP_003477.4).
Sequence MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNITLLNGVAIIVGTIIGSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYMLEVYG
Gene ID 8140
Swiss prot Q01650
Synonyms E16; CD98; LAT1; 4F2LC; MPE16; D16S469E; LAT1/SLC7A5
Calculated MW 55kDa
Observed MW 39kDa/50kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse testis
Cellular location Apical cell membrane, Cytoplasm, Multi-pass membrane protein, cytosol
Customer validation

(Pancreatic cancer cells)

WB (Sus scrofa, Homo sapiens)

IF (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

LAT1/SLC7A5 Rabbit pAb images

ABclonal:Western blot - LAT1/SLC7A5 Rabbit pAb (A2833)}

Western blot - LAT1/SLC7A5 Rabbit pAb (A2833)

Western blot analysis of Mouse testis, using LAT1/SLC7A5 antibody (A2833) at 1:900 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunofluorescence - LAT1/SLC7A5 Rabbit pAb (A2833)}

Immunofluorescence - LAT1/SLC7A5 Rabbit pAb (A2833)

Immunofluorescence analysis of MCF7 cells using LAT1/SLC7A5 Rabbit pAb (A2833) at dilution of 1:300 (40x lens). Blue: DAPI for nuclear staining.

Submit an review for A2833

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2833 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SLC7A5. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SLC7A5. (Distance between topics and target gene indicate popularity.) SLC7A5

* Data provided by citexs.com, for reference only.

Publishing research using A2833? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order