Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SLC34A2 Rabbit pAb (A9460)

Publications (2) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - SLC34A2 Rabbit pAb (A9460)

Western blot analysis of various lysates using SLC34A2 Rabbit pAb (A9460) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name SLC34A2 Rabbit pAb
Catalog No. A9460
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 234-362 of human SLC34A2 (NP_001171469.1).
Sequence EVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDLA
Gene ID 10568
Swiss prot O95436
Synonyms PULAM; NPTIIb; NaPi2b; NAPI-3B; NAPI-IIb; SLC34A2
Calculated MW 76kDa
Observed MW 76kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples A-549, 293T, HT-29, MCF7, Mouse small intestine, Rat lung
Cellular location Membrane, Multi-pass membrane protein
Customer validation

WB (Gallus gallus, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

SLC34A2 Rabbit pAb images

ABclonal:Western blot - SLC34A2 Rabbit pAb (A9460)}

Western blot - SLC34A2 Rabbit pAb (A9460)

Western blot analysis of various lysates using SLC34A2 Rabbit pAb (A9460) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A9460 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SLC34A2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SLC34A2. (Distance between topics and target gene indicate popularity.) SLC34A2

* Data provided by citexs.com, for reference only.

Publishing research using A9460? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order