Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SLC30A6 Rabbit pAb (A11644)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - SLC30A6 Rabbit pAb (A11644)

Western blot analysis of various lysates using SLC30A6 Rabbit pAb (A11644) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name SLC30A6 Rabbit pAb
Catalog No. A11644
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of a family of proteins that function as zinc transporters. This protein can regulate subcellular levels of zinc in the Golgi and vesicles. Expression of this gene is altered in the Alzheimer's disease brain plaques.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 252-461 of human SLC30A6 (NP_060434.2).
Sequence KVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIPMPLLKGTDDLNPVTSTPAKPSSPPPEFSFNTPGKNVNPVILLNTQTRPYGFGLNHGHTPYSSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP
Gene ID 55676
Swiss prot Q6NXT4
Synonyms ZNT6; MST103; MSTP103; SLC30A6
Calculated MW 51kDa
Observed MW 51kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-87MG, Mouse brain, Rat brain
Cellular location Golgi apparatus, Multi-pass membrane protein, trans-Golgi network membrane

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

SLC30A6 Rabbit pAb images

ABclonal:Western blot - SLC30A6 Rabbit pAb (A11644)}

Western blot - SLC30A6 Rabbit pAb (A11644)

Western blot analysis of various lysates using SLC30A6 Rabbit pAb (A11644) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A11644 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SLC30A6. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SLC30A6. (Distance between topics and target gene indicate popularity.) SLC30A6

* Data provided by citexs.com, for reference only.

Publishing research using A11644? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order