Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

GLUT4 Rabbit pAb (A7637)

Review (1) Publications (24) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - GLUT4 Rabbit pAb (A7637)

Western blot analysis of various lysates using GLUT4 Rabbit pAb (A7637) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - GLUT4 Rabbit pAb (A7637)

Western blot analysis of various lysates using GLUT4 Rabbit pAb (A7637) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - GLUT4 Rabbit pAb (A7637)

Immunohistochemistry analysis of GLUT4 in paraffin-embedded mouse skeletal muscle using GLUT4 Rabbit pAb (A7637) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - GLUT4 Rabbit pAb (A7637)

Immunohistochemistry analysis of GLUT4 in paraffin-embedded mouse skeletal muscle using GLUT4 Rabbit pAb (A7637) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - GLUT4 Rabbit pAb (A7637)

Immunofluorescence analysis of paraffin-embedded Mouse skeletal muscle using GLUT4 Rabbit pAb (A7637) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - GLUT4 Rabbit pAb (A7637)

Immunofluorescence analysis of RD cells using GLUT4 Rabbit pAb (A7637) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - GLUT4 Rabbit pAb (A7637)

Immunofluorescence analysis of C2C12 cells using GLUT4 Rabbit pAb (A7637) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for GLUT4 Rabbit pAb(A7637)

You may also interested in:

Overview

Product name GLUT4 Rabbit pAb
Catalog No. A7637
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM).

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-509 of human GLUT4 (NP_001033.1).
Sequence FLLFAVLLLGFFIFTFLRVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND
Gene ID 6517
Swiss prot P14672
Synonyms GLUT4
Calculated MW 55kDa
Observed MW 55kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, RD, Jurkat, NIH/3T3, H9C2
Cellular location Cell membrane, Cytoplasm, Endomembrane system, Multi-pass membrane protein, perinuclear region
Customer validation

WB (Mouse heart tissueHomo sapiens, Mus musculus, Homo sapiens, Rattus norvegicus)

IHC (Mesocricetus auratus, Homo sapiens, Mus musculus)

IF (Mus musculus, Rattus norvegicus)

ELISA (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

GLUT4 Rabbit pAb images

ABclonal:Western blot - GLUT4 Rabbit pAb (A7637)}

Western blot - GLUT4 Rabbit pAb (A7637)

Western blot analysis of various lysates using GLUT4 Rabbit pAb (A7637) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - GLUT4 Rabbit pAb (A7637)}

Western blot - GLUT4 Rabbit pAb (A7637)

Western blot analysis of various lysates using GLUT4 Rabbit pAb (A7637) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - GLUT4 Rabbit pAb (A7637)}

Immunohistochemistry - GLUT4 Rabbit pAb (A7637)

Immunohistochemistry analysis of GLUT4 in paraffin-embedded mouse skeletal muscle using GLUT4 Rabbit pAb (A7637) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - GLUT4 Rabbit pAb (A7637)}

Immunohistochemistry - GLUT4 Rabbit pAb (A7637)

Immunohistochemistry analysis of GLUT4 in paraffin-embedded mouse skeletal muscle using GLUT4 Rabbit pAb (A7637) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - GLUT4 Rabbit pAb (A7637)}

Immunofluorescence - GLUT4 Rabbit pAb (A7637)

Immunofluorescence analysis of paraffin-embedded Mouse skeletal muscle using GLUT4 Rabbit pAb (A7637) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - GLUT4 Rabbit pAb (A7637)}

Immunofluorescence - GLUT4 Rabbit pAb (A7637)

Immunofluorescence analysis of RD cells using GLUT4 Rabbit pAb (A7637) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - GLUT4 Rabbit pAb (A7637)}

Immunofluorescence - GLUT4 Rabbit pAb (A7637)

Immunofluorescence analysis of C2C12 cells using GLUT4 Rabbit pAb (A7637) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A7637

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A7637 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SLC2A4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SLC2A4. (Distance between topics and target gene indicate popularity.) SLC2A4

* Data provided by citexs.com, for reference only.

Publishing research using A7637? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Antibodies (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order