Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SLC28A3 Rabbit pAb (A10320)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - SLC28A3 Rabbit pAb (A10320)

Western blot analysis of extracts of various cell lines, using SLC28A3 antibody (A10320) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

You may also interested in:

Overview

Product name SLC28A3 Rabbit pAb
Catalog No. A10320
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Nucleoside transporters, such as SLC28A3, regulate multiple cellular processes, including neurotransmission, vascular tone, adenosine concentration in the vicinity of cell surface receptors, and transport and metabolism of nucleoside drugs. SLC28A3 shows broad specificity for pyrimidine and purine nucleosides (Ritzel et al., 2001 [PubMed 11032837]).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 612-691 of human SLC28A3 (NP_071410.1).
Sequence LSSTPVDINCHHVLENAFNSTFPGNTTKVIACCQSLLSSTVAKGPGEVIPGGNHSLYSLKGCCTLLNPSTFNCNGISNTF
Gene ID 64078
Swiss prot Q9HAS3
Synonyms CNT3; SLC28A3
Calculated MW 77kDa
Observed MW 77kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HepG2, 293T
Cellular location Cell membrane, Endoplasmic reticulum membrane, Multi-pass membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

SLC28A3 Rabbit pAb images

ABclonal:Western blot - SLC28A3 Rabbit pAb (A10320)}

Western blot - SLC28A3 Rabbit pAb (A10320)

Western blot analysis of extracts of various cell lines, using SLC28A3 antibody (A10320) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Inquire About This Product

Submit your question about A10320 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SLC28A3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SLC28A3. (Distance between topics and target gene indicate popularity.) SLC28A3

* Data provided by citexs.com, for reference only.

Publishing research using A10320? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order