Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SLC25A38 Rabbit pAb (A13218)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - SLC25A38 Rabbit pAb (A13218)

Western blot analysis of extracts of 293T cells, using SLC25A38 antibody (A13218) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - SLC25A38 Rabbit pAb (A13218)

Immunofluorescence analysis of NIH/3T3 cells using SLC25A38 antibody (A13218) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name SLC25A38 Rabbit pAb
Catalog No. A13218
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of the mitochondrial carrier family. The encoded protein is required during erythropoiesis and is important for the biosynthesis of heme. Mutations in this gene are the cause of autosomal congenital sideroblastic anemia (anemia, sideroblastic, 2, pyridoxine-refractory). A related pseudogene is found on chromosome 1.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC25A38 (NP_060345.2).
Sequence MIQNSRPSLLQPQDVGDTVETLMLHPVIKAFLCGSISGTCSTLLFQPLDLLKTRLQTLQPSDHGSRRVGMLAVLLKVVRTESLLGLWKGMSPSIVRCVPG
Gene ID 54977
Swiss prot Q96DW6
Synonyms SIDBA2; SLC25A38
Calculated MW 34kDa
Observed MW 33kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples 293T
Cellular location Mitochondrion inner membrane, Multi-pass membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SLC25A38 Rabbit pAb images

ABclonal:Western blot - SLC25A38 Rabbit pAb (A13218)}

Western blot - SLC25A38 Rabbit pAb (A13218)

Western blot analysis of extracts of 293T cells, using SLC25A38 antibody (A13218) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - SLC25A38 Rabbit pAb (A13218)}

Immunofluorescence - SLC25A38 Rabbit pAb (A13218)

Immunofluorescence analysis of NIH/3T3 cells using SLC25A38 antibody (A13218) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A13218 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SLC25A38. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SLC25A38. (Distance between topics and target gene indicate popularity.) SLC25A38

* Data provided by citexs.com, for reference only.

Publishing research using A13218? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order