Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

EAAT1/SLC1A3 Rabbit pAb (A15722)

Publications (3) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - EAAT1/SLC1A3 Rabbit pAb (A15722)

Western blot analysis of various lysates using EAAT1/SLC1A3 Rabbit pAb (A15722) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name EAAT1/SLC1A3 Rabbit pAb
Catalog No. A15722
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of a member of a high affinity glutamate transporter family. This gene functions in the termination of excitatory neurotransmission in central nervous system. Mutations are associated with episodic ataxia, Type 6. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 453-542 of human EAAT1/EAAT1/SLC1A3 (NP_004163.3).
Sequence IVLTSVGLPTDDITLIIAVDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM
Gene ID 6507
Swiss prot P43003
Synonyms EA6; EAAT1; GLAST; GLAST1; EAAT1/SLC1A3
Calculated MW 60kDa
Observed MW 70kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:100 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples 293T, U-251MG, HeLa, H460, C6, Rat lung
Cellular location Membrane, Multi-pass membrane protein
Customer validation

WB (Mus musculus)

IHC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

EAAT1/SLC1A3 Rabbit pAb images

ABclonal:Western blot - EAAT1/SLC1A3 Rabbit pAb (A15722)}

Western blot - EAAT1/SLC1A3 Rabbit pAb (A15722)

Western blot analysis of various lysates using EAAT1/SLC1A3 Rabbit pAb (A15722) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A15722 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SLC1A3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SLC1A3. (Distance between topics and target gene indicate popularity.) SLC1A3

* Data provided by citexs.com, for reference only.

Publishing research using A15722? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order