Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SLC15A1 Rabbit pAb (A10246)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - SLC15A1 Rabbit pAb (A10246)

Western blot analysis of extracts of various cell lines, using SLC15A1 antibody (A10246) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

You may also interested in:

Overview

Product name SLC15A1 Rabbit pAb
Catalog No. A10246
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes an intestinal hydrogen peptide cotransporter that is a member of the solute carrier family 15. The encoded protein is localized to the brush border membrane of the intestinal epithelium and mediates the uptake of di- and tripeptides from the lumen into the enterocytes. This protein plays an important role in the uptake and digestion of dietary proteins. This protein also facilitates the absorption of numerous peptidomimetic drugs.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-700 of human SLC15A1 (NP_005064.1).
Sequence VTGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQFSKQWAEYILFAALLLVVCVIFAIMARFYTYINPAEIEAQFDEDEKKNRLEKSNPYFMS
Gene ID 6564
Swiss prot P46059
Synonyms PEPT1; HPECT1; HPEPT1; SLC15A1
Calculated MW 79kDa
Observed MW 78kDa

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse lung, Rat testis
Cellular location Membrane, Multi-pass membrane protein

SLC15A1 Rabbit pAb images

ABclonal:Western blot - SLC15A1 Rabbit pAb (A10246)}

Western blot - SLC15A1 Rabbit pAb (A10246)

Western blot analysis of extracts of various cell lines, using SLC15A1 antibody (A10246) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Inquire About This Product

Submit your question about A10246 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SLC15A1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SLC15A1. (Distance between topics and target gene indicate popularity.) SLC15A1

* Data provided by citexs.com, for reference only.

Publishing research using A10246? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order