Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CD150/SLAM Rabbit pAb (A2044)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - CD150/SLAM Rabbit pAb (A2044)

Western blot analysis of extracts of various cell lines, using CD150/SLAM antibody (A2044) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

You may also interested in:

Overview

Product name CD150/SLAM Rabbit pAb
Catalog No. A2044
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables SH2 domain binding activity and identical protein binding activity. Involved in several processes, including negative regulation of CD40 signaling pathway; negative regulation of cytokine production; and positive regulation of MAPK cascade. Located in extracellular exosome.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-237 of human CD150/SLAM (NP_003028.1).
Sequence ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKP
Gene ID 6504
Swiss prot Q13291
Synonyms SLAM; CD150; CDw150; CD150/SLAM
Calculated MW 37kDa
Observed MW 37kDa/65kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Jurkat, Mouse liver
Cellular location Cell membrane, Single-pass type I membrane protein
Customer validation

IF (Canis lupus familiaris)

Co-IP (Canis lupus familiaris)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD150/SLAM Rabbit pAb images

ABclonal:Western blot - CD150/SLAM Rabbit pAb (A2044)}

Western blot - CD150/SLAM Rabbit pAb (A2044)

Western blot analysis of extracts of various cell lines, using CD150/SLAM antibody (A2044) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Inquire About This Product

Submit your question about A2044 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SLAMF1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SLAMF1. (Distance between topics and target gene indicate popularity.) SLAMF1

* Data provided by citexs.com, for reference only.

Publishing research using A2044? Please let us know so that we can cite the reference in this datasheet.

Proteins (1)

Antibodies (5)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order