Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CD62P/P-selectin Rabbit pAb (A12501)

Publication (1) Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - CD62P/P-selectin Rabbit pAb (A12501)

Western blot analysis of lysates from mouse kidney, using CD62P/P-selectin Rabbit pAb (A12501) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

You may also interested in:

Overview

Product name CD62P/P-selectin Rabbit pAb
Catalog No. A12501
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a 140 kDa protein that is stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. This protein redistributes to the plasma membrane during platelet activation and degranulation and mediates the interaction of activated endothelial cells or platelets with leukocytes. The membrane protein is a calcium-dependent receptor that binds to sialylated forms of Lewis blood group carbohydrate antigens on neutrophils and monocytes. Alternative splice variants may occur but are not well documented.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 220-319 of human CD62P/P-selectin (NP_002996.2).
Sequence FSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVGPEVVQCTASGVWTAPAPVC
Gene ID 6403
Swiss prot P16109
Synonyms CD62; GRMP; PSEL; CD62P; GMP140; LECAM3; PADGEM; CD62P/P-selectin
Calculated MW 91kDa
Observed MW 91kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse kidney
Cellular location Membrane, Single-pass type I membrane protein
Customer validation

WB (Mus musculus)

Research Area

CD62P/P-selectin Rabbit pAb images

ABclonal:Western blot - CD62P/P-selectin Rabbit pAb (A12501)}

Western blot - CD62P/P-selectin Rabbit pAb (A12501)

Western blot analysis of lysates from mouse kidney, using CD62P/P-selectin Rabbit pAb (A12501) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Inquire About This Product

Submit your question about A12501 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SELP. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SELP. (Distance between topics and target gene indicate popularity.) SELP

* Data provided by citexs.com, for reference only.

Publishing research using A12501? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Proteins (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order