Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

RhoA Rabbit pAb (A13947)

Publications (4) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - RhoA Rabbit pAb (A13947)

Western blot analysis of various lysates using RhoA Rabbit pAb (A13947) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunohistochemistry - RhoA Rabbit pAb (A13947)

Immunohistochemistry analysis of RhoA in paraffin-embedded human placenta using RhoA Rabbit pAb (A13947) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name RhoA Rabbit pAb
Catalog No. A13947
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 94-193 of human RhoA (NP_001655.1).
Sequence NIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Gene ID 387
Swiss prot P61586
Synonyms ARHA; ARH12; RHO12; EDFAOB; RHOH12; RhoA
Calculated MW 22kDa
Observed MW 21kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples NIH/3T3, Mouse lung
Cellular location Cell membrane, Cell projection, Cleavage furrow, Cytoplasm, Cytoplasmic side, Lipid-anchor, Midbody, cell cortex, cytoskeleton, lamellipodium
Customer validation

WB (Homo sapiens, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

RhoA Rabbit pAb images

ABclonal:Western blot - RhoA Rabbit pAb (A13947)}

Western blot - RhoA Rabbit pAb (A13947)

Western blot analysis of various lysates using RhoA Rabbit pAb (A13947) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Immunohistochemistry - RhoA Rabbit pAb (A13947)}

Immunohistochemistry - RhoA Rabbit pAb (A13947)

Immunohistochemistry analysis of RhoA in paraffin-embedded human placenta using RhoA Rabbit pAb (A13947) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A13947 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RHOA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RHOA. (Distance between topics and target gene indicate popularity.) RHOA

* Data provided by citexs.com, for reference only.

Publishing research using A13947? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order