Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] RB Rabbit pAb (A0003)

KO/KDValidated

Publications (6) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - [KO Validated] RB Rabbit pAb (A0003)

Western blot analysis of various lysates using [KO Validated] RB Rabbit pAb (A0003) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Western blot - [KO Validated] RB Rabbit pAb (A0003)

Western blot analysis of lysates from wild type (WT) and RB knockout (KO) HeLa cells, using [KO Validated] RB Rabbit pAb (A0003) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - [KO Validated] RB Rabbit pAb (A0003)

Immunofluorescence analysis of Y79 cells using [KO Validated] RB Rabbit pAb (A0003) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name [KO Validated] RB Rabbit pAb
Catalog No. A0003
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a negative regulator of the cell cycle and was the first tumor suppressor gene found. The encoded protein also stabilizes constitutive heterochromatin to maintain the overall chromatin structure. The active, hypophosphorylated form of the protein binds transcription factor E2F1. Defects in this gene are a cause of childhood cancer retinoblastoma (RB), bladder cancer, and osteogenic sarcoma.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human RB (NP_000312.2).
Sequence RSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH
Gene ID 5925
Swiss prot P06400
Synonyms RB; pRb; OSRC; pp110; p105-Rb; PPP1R130; p110-RB1
Calculated MW 106kDa
Observed MW 110kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HeLa, A-431
Cellular location Nucleus
Customer validation

WB (Homo sapiens, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] RB Rabbit pAb images

ABclonal:Western blot - [KO Validated] RB Rabbit pAb (A0003)}

Western blot - [KO Validated] RB Rabbit pAb (A0003)

Western blot analysis of various lysates using [KO Validated] RB Rabbit pAb (A0003) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Western blot - [KO Validated] RB Rabbit pAb (A0003)}

Western blot - [KO Validated] RB Rabbit pAb (A0003)

Western blot analysis of lysates from wild type (WT) and RB knockout (KO) HeLa cells, using [KO Validated] RB Rabbit pAb (A0003) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - [KO Validated] RB Rabbit pAb (A0003)}

Immunofluorescence - [KO Validated] RB Rabbit pAb (A0003)

Immunofluorescence analysis of Y79 cells using [KO Validated] RB Rabbit pAb (A0003) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A0003 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RB1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RB1. (Distance between topics and target gene indicate popularity.) RB1

* Data provided by citexs.com, for reference only.

Publishing research using A0003? Please let us know so that we can cite the reference in this datasheet.

Antibodies (14)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Alternative Products
Contact us to order