Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Reptin/RUVBL2 Rabbit pAb (A1905)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Reptin/RUVBL2 Rabbit pAb (A1905)

Western blot analysis of various lysates using Reptin/RUVBL2 Rabbit pAb (A1905) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - Reptin/RUVBL2 Rabbit pAb (A1905)

Immunofluorescence analysis of U2OS cells using Reptin/RUVBL2 Rabbit pAb (A1905). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - Reptin/RUVBL2 Rabbit pAb (A1905)

Immunoprecipitation analysis of 200 μg extracts of K-562 cells using 3 μg Reptin/Reptin/RUVBL2 antibody (A1905). Western blot was performed from the immunoprecipitate using Reptin/Reptin/RUVBL2 antibody (A1905) at a dilution of 1:1000.

You may also interested in:

Overview

Product name Reptin/RUVBL2 Rabbit pAb
Catalog No. A1905
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase and DNA helicase activities. This gene is physically linked to the CGB/LHB gene cluster on chromosome 19q13.3, and is very close (55 nt) to the LHB gene, in the opposite orientation.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-463 of human Reptin/Reptin/RUVBL2 (NP_006657.1).
Sequence MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS
Gene ID 10856
Swiss prot Q9Y230
Synonyms RVB2; TIH2; ECP51; TIP48; CGI-46; ECP-51; INO80J; REPTIN; TIP49B; TAP54-beta; Reptin/RUVBL2
Calculated MW 51kDa
Observed MW 50kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    Immunoprecipitation    
Positive samples BT-474, K-562, SW480, MCF-7, 22Rv1, 293T
Cellular location Cytoplasm, Membrane, Nucleus, Nucleus matrix, nucleoplasm
Customer validation

WB (Homo sapiens, Mus musculus)

ChIP (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Reptin/RUVBL2 Rabbit pAb images

ABclonal:Western blot - Reptin/RUVBL2 Rabbit pAb (A1905)}

Western blot - Reptin/RUVBL2 Rabbit pAb (A1905)

Western blot analysis of various lysates using Reptin/RUVBL2 Rabbit pAb (A1905) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - Reptin/RUVBL2 Rabbit pAb (A1905)}

Immunofluorescence - Reptin/RUVBL2 Rabbit pAb (A1905)

Immunofluorescence analysis of U2OS cells using Reptin/RUVBL2 Rabbit pAb (A1905). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - Reptin/RUVBL2 Rabbit pAb (A1905)}

Immunoprecipitation - Reptin/RUVBL2 Rabbit pAb (A1905)

Immunoprecipitation analysis of 200 μg extracts of K-562 cells using 3 μg Reptin/Reptin/RUVBL2 antibody (A1905). Western blot was performed from the immunoprecipitate using Reptin/Reptin/RUVBL2 antibody (A1905) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A1905 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RUVBL2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RUVBL2. (Distance between topics and target gene indicate popularity.) RUVBL2

* Data provided by citexs.com, for reference only.

Publishing research using A1905? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order