Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

S6 Ribosomal Protein (RPS6) Rabbit pAb (A6058)

Publications (20) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - S6 Ribosomal Protein (RPS6) Rabbit pAb (A6058)

Western blot analysis of extracts of various cell lines, using S6 Ribosomal Protein (RPS6) antibody (A6058) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - S6 Ribosomal Protein (RPS6) Rabbit pAb (A6058)

Immunohistochemistry analysis of paraffin-embedded human colon using S6 Ribosomal Protein (RPS6) Rabbit pAb (A6058) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - S6 Ribosomal Protein (RPS6) Rabbit pAb (A6058)

Immunofluorescence analysis of NIH/3T3 cells using S6 Ribosomal Protein (RPS6) Rabbit pAb (A6058) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name S6 Ribosomal Protein (RPS6) Rabbit pAb
Catalog No. A6058
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-130 of human RPS6 (NP_001001.2).
Sequence MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVP
Gene ID 6194
Swiss prot P62753
Synonyms S6; eS6; S6 Ribosomal Protein (RPS6)
Calculated MW 29kDa
Observed MW 32kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples SKOV3, Raji, HT-29, A-431, Mouse heart
Cellular location cytoplasm, cytoplasmic ribonucleoprotein granule, cytosol, cytosolic ribosome, endoplasmic reticulum, nucleolus, nucleoplasm, nucleus, perinuclear region of cytoplasm
Customer validation

WB (Mus musculus, Yeast, Homo sapiens, Sus scrofa, Agrobacterium tumefaciens, Pelteobagrus fulvidraco)

IHC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

S6 Ribosomal Protein (RPS6) Rabbit pAb images

ABclonal:Western blot - S6 Ribosomal Protein (RPS6) Rabbit pAb (A6058)}

Western blot - S6 Ribosomal Protein (RPS6) Rabbit pAb (A6058)

Western blot analysis of extracts of various cell lines, using S6 Ribosomal Protein (RPS6) antibody (A6058) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - S6 Ribosomal Protein (RPS6) Rabbit pAb (A6058)}

Immunohistochemistry - S6 Ribosomal Protein (RPS6) Rabbit pAb (A6058)

Immunohistochemistry analysis of paraffin-embedded human colon using S6 Ribosomal Protein (RPS6) Rabbit pAb (A6058) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - S6 Ribosomal Protein (RPS6) Rabbit pAb (A6058)}

Immunofluorescence - S6 Ribosomal Protein (RPS6) Rabbit pAb (A6058)

Immunofluorescence analysis of NIH/3T3 cells using S6 Ribosomal Protein (RPS6) Rabbit pAb (A6058) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A6058 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RPS6. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RPS6. (Distance between topics and target gene indicate popularity.) RPS6

* Data provided by citexs.com, for reference only.

Publishing research using A6058? Please let us know so that we can cite the reference in this datasheet.

Antibodies (9)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order