Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

RELL2 Rabbit pAb (A10620)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

You may also interested in:

Overview

Product name RELL2 Rabbit pAb
Catalog No. A10620
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable collagen binding activity. Involved in positive regulation of p38MAPK cascade. Predicted to be located in extracellular matrix.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 44-303 of human RELL2 (NP_776189.3).
Sequence YRCRTSRGSEPDDAQLQPPEDDDMNEDTVERIVRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSHHHTVHLGSAAPCLHCSRSKRPPLVRQGRSKEGKSRPRTGETTVFSVGRFRVTHIEKRYGLHEHRDGSPTDRSWGSGGGQDPGGGQGSGGGQPKAGMPAMERLPPERPQPQVLASPPVQNGGLRDSSLTPRALEGNPRASAEPTLRAGGRGPSPGLPTQEANGQPSKPDTSDHQVSLPQGAGSM
Gene ID 285613
Swiss prot Q8NC24
Synonyms C5orf16; RELL2
Calculated MW 32kDa
Observed MW Refer to figures

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key
Positive samples
Cellular location Cell membrane, Single-pass membrane protein

Inquire About This Product

Submit your question about A10620 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RELL2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RELL2. (Distance between topics and target gene indicate popularity.) RELL2

* Data provided by citexs.com, for reference only.

Publishing research using A10620? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order