Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

RARβ Rabbit pAb (A1603)

Publication (1) Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Rat

ABclonal:Western blot - RARβ Rabbit pAb (A1603)

Western blot analysis of various lysates using RARβ Rabbit pAb (A1603) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name RARβ Rabbit pAb
Catalog No. A1603
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. The gene was first identified in a hepatocellular carcinoma where it flanks a hepatitis B virus integration site. Alternate promoter usage and differential splicing result in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-340 of human RARβ (NP_057236.1).
Sequence SKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
Gene ID 5915
Swiss prot P10826
Synonyms HAP; RRB2; NR1B2; MCOPS12; RARbeta; RARbeta1; RARβ
Calculated MW 50kDa
Observed MW 60kDa

Applications

Reactivity Human, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples A-549, BT-474, NCI-H460
Cellular location Cytoplasm, Nucleus, Nucleus
Customer validation

WB (Homo sapiens)

Research Area

RARβ Rabbit pAb images

ABclonal:Western blot - RARβ Rabbit pAb (A1603)}

Western blot - RARβ Rabbit pAb (A1603)

Western blot analysis of various lysates using RARβ Rabbit pAb (A1603) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A1603 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RARB. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RARB. (Distance between topics and target gene indicate popularity.) RARB

* Data provided by citexs.com, for reference only.

Publishing research using A1603? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order