Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

RGAP1 Rabbit pAb (A5298)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - RGAP1 Rabbit pAb (A5298)

Western blot analysis of extracts of various cell lines, using RGAP1 antibody (A5298) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - RGAP1 Rabbit pAb (A5298)

Immunohistochemistry analysis of paraffin-embedded human breast cancer using RGAP1 Rabbit pAb (A5298) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - RGAP1 Rabbit pAb (A5298)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using RGAP1 Rabbit pAb (A5298) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - RGAP1 Rabbit pAb (A5298)

Immunofluorescence analysis of U2OS cells using RGAP1 antibody (A5298). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name RGAP1 Rabbit pAb
Catalog No. A5298
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a GTPase-activating protein (GAP) that is a compoment of the centralspindlin complex. This protein binds activated forms of Rho GTPases and stimulates GTP hydrolysis, which results in negative regulation of Rho-mediated signals. This protein plays a regulatory role in cytokinesis, cell growth, and differentiation. Alternatively spliced transcript variants have been found for this gene. There is a pseudogene for this gene on chromosome 12.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 353-632 of human RGAP1 (NP_001119576.1).
Sequence DFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICSLLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHLQRVAQSPHTKMDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWSQFMMVEQENIDPLHVIENSNAFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPMLK
Gene ID 29127
Swiss prot Q9H0H5
Synonyms CYK4; CDAN3B; ID-GAP; HsCYK-4; MgcRacGAP; RGAP1
Calculated MW 71kDa
Observed MW 71kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, 293T, K-562, Mouse testis, Mouse thymus, Rat testis
Cellular location Cell membrane, Cleavage furrow, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Midbody, Nucleus, Peripheral membrane protein, acrosome, cytoskeleton, secretory vesicle, spindle
Customer validation

WB (Homo sapiens, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

RGAP1 Rabbit pAb images

ABclonal:Western blot - RGAP1 Rabbit pAb (A5298)}

Western blot - RGAP1 Rabbit pAb (A5298)

Western blot analysis of extracts of various cell lines, using RGAP1 antibody (A5298) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - RGAP1 Rabbit pAb (A5298)}

Immunohistochemistry - RGAP1 Rabbit pAb (A5298)

Immunohistochemistry analysis of paraffin-embedded human breast cancer using RGAP1 Rabbit pAb (A5298) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - RGAP1 Rabbit pAb (A5298)}

Immunohistochemistry - RGAP1 Rabbit pAb (A5298)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using RGAP1 Rabbit pAb (A5298) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - RGAP1 Rabbit pAb (A5298)}

Immunofluorescence - RGAP1 Rabbit pAb (A5298)

Immunofluorescence analysis of U2OS cells using RGAP1 antibody (A5298). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A5298 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RACGAP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RACGAP1. (Distance between topics and target gene indicate popularity.) RACGAP1

* Data provided by citexs.com, for reference only.

Publishing research using A5298? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order