Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

RAB4A Rabbit pAb (A13540)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Immunohistochemistry - RAB4A Rabbit pAb (A13540)

Immunohistochemistry analysis of RAB4A in paraffin-embedded mouse spinal cord using RAB4A Rabbit pAb (A13540) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - RAB4A Rabbit pAb (A13540)

Immunohistochemistry analysis of RAB4A in paraffin-embedded mouse stomach using RAB4A Rabbit pAb (A13540) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - RAB4A Rabbit pAb (A13540)

Immunofluorescence analysis of NIH/3T3 cells using RAB4A Rabbit pAb (A13540) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - RAB4A Rabbit pAb (A13540)

Immunofluorescence analysis of PC-12 cells using RAB4A Rabbit pAb (A13540) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - RAB4A Rabbit pAb (A13540)

Immunofluorescence analysis of U2OS cells using RAB4A Rabbit pAb (A13540) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name RAB4A Rabbit pAb
Catalog No. A13540
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of the largest group in the Ras superfamily of small GTPases, which regulate membrane trafficking. The encoded protein is associated with early endosomes and is involved in their sorting and recycling. The protein also plays a role in regulating the recycling of receptors from endosomes to the plasma membrane. Alternatively spliced transcript variants have been observed for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human RAB4A (NP_004569.2).
Sequence FGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENEL
Gene ID 5867
Swiss prot P20338
Synonyms RAB4; HRES1; HRES-1; HRES-1/RAB4; RAB4A
Calculated MW 24kDa
Observed MW

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Immunohistochemistry    Immunofluorescence    
Positive samples
Cellular location Cytoplasm, Membrane, Peripheral membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

RAB4A Rabbit pAb images

ABclonal:Immunohistochemistry - RAB4A Rabbit pAb (A13540)}

Immunohistochemistry - RAB4A Rabbit pAb (A13540)

Immunohistochemistry analysis of RAB4A in paraffin-embedded mouse spinal cord using RAB4A Rabbit pAb (A13540) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - RAB4A Rabbit pAb (A13540)}

Immunohistochemistry - RAB4A Rabbit pAb (A13540)

Immunohistochemistry analysis of RAB4A in paraffin-embedded mouse stomach using RAB4A Rabbit pAb (A13540) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - RAB4A Rabbit pAb (A13540)}

Immunofluorescence - RAB4A Rabbit pAb (A13540)

Immunofluorescence analysis of NIH/3T3 cells using RAB4A Rabbit pAb (A13540) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - RAB4A Rabbit pAb (A13540)}

Immunofluorescence - RAB4A Rabbit pAb (A13540)

Immunofluorescence analysis of PC-12 cells using RAB4A Rabbit pAb (A13540) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - RAB4A Rabbit pAb (A13540)}

Immunofluorescence - RAB4A Rabbit pAb (A13540)

Immunofluorescence analysis of U2OS cells using RAB4A Rabbit pAb (A13540) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A13540 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RAB4A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RAB4A. (Distance between topics and target gene indicate popularity.) RAB4A

* Data provided by citexs.com, for reference only.

Publishing research using A13540? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order