Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

RAB27B Rabbit pAb (A10389)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - RAB27B Rabbit pAb (A10389)

Western blot analysis of various lysates, using RAB27B Rabbit pAb (A10389) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 25s.

ABclonal:Western blot - RAB27B Rabbit pAb (A10389)

Western blot analysis of lysates from Mouse stomach, using RAB27B Rabbit pAb (A10389) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

You may also interested in:

Overview

Product name RAB27B Rabbit pAb
Catalog No. A10389
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables guanyl ribonucleotide binding activity; myosin V binding activity; and protein domain specific binding activity. Involved in multivesicular body sorting pathway and positive regulation of exocytosis. Located in Golgi stack and cytoplasmic vesicle.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-218 of human RAB27B (NP_004154.2).
Sequence MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
Gene ID 5874
Swiss prot O00194
Synonyms C25KG; RAB27B
Calculated MW 25kDa
Observed MW 27kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples A-549, U-87MG, Mouse stomach
Cellular location Lipid-anchor, Membrane
Customer validation

WB (Rattus norvegicus, Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

RAB27B Rabbit pAb images

ABclonal:Western blot - RAB27B Rabbit pAb (A10389)}

Western blot - RAB27B Rabbit pAb (A10389)

Western blot analysis of various lysates, using RAB27B Rabbit pAb (A10389) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 25s.
ABclonal:Western blot - RAB27B Rabbit pAb (A10389)}

Western blot - RAB27B Rabbit pAb (A10389)

Western blot analysis of lysates from Mouse stomach, using RAB27B Rabbit pAb (A10389) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Inquire About This Product

Submit your question about A10389 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RAB27B. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RAB27B. (Distance between topics and target gene indicate popularity.) RAB27B

* Data provided by citexs.com, for reference only.

Publishing research using A10389? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order