Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

RAB24 Rabbit pAb (A8394)

Review (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - RAB24 Rabbit pAb (A8394)

Western blot analysis of various lysates using RAB24 Rabbit pAb (A8394) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 15s.

ABclonal:Immunoprecipitation - RAB24 Rabbit pAb (A8394)

Immunoprecipitation analysis of 200 μg extracts of MCF-7 cells, using 3 μg RAB24 antibody (A8394). Western blot was performed from the immunoprecipitate using RAB24 antibody (A8394) at a dilution of 1:1000.

Review
ABclonal: review for RAB24 Rabbit pAb(A8394)

You may also interested in:

Overview

Product name RAB24 Rabbit pAb
Catalog No. A8394
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

RAB24 is a small GTPase of the Rab subfamily of Ras-related proteins that regulate intracellular protein trafficking (Olkkonen et al., 1993 [PubMed 8126105]).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-203 of human RAB24 (NP_001026847.1).
Sequence MSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH
Gene ID 53917
Swiss prot Q969Q5
Synonyms RAB24
Calculated MW 23kDa
Observed MW 23kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples HT-1080, MCF7, SH-SY5Y, 293T, Mouse brain
Cellular location Cytoplasm, Lipid-anchor, Membrane, cytosol
Customer validation

WB (Human liver cancer)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

RAB24 Rabbit pAb images

ABclonal:Western blot - RAB24 Rabbit pAb (A8394)}

Western blot - RAB24 Rabbit pAb (A8394)

Western blot analysis of various lysates using RAB24 Rabbit pAb (A8394) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 15s.
ABclonal:Immunoprecipitation - RAB24 Rabbit pAb (A8394)}

Immunoprecipitation - RAB24 Rabbit pAb (A8394)

Immunoprecipitation analysis of 200 μg extracts of MCF-7 cells, using 3 μg RAB24 antibody (A8394). Western blot was performed from the immunoprecipitate using RAB24 antibody (A8394) at a dilution of 1:1000.

Submit an review for A8394

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A8394 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RAB24. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RAB24. (Distance between topics and target gene indicate popularity.) RAB24

* Data provided by citexs.com, for reference only.

Publishing research using A8394? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order