Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] RAB1B Rabbit pAb (A7514)

KO/KDValidated

Review (1) Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - [KO Validated] RAB1B Rabbit pAb (A7514)

Western blot analysis of lysates from wild type (WT) and RAB1B knockout (KO) HeLa cells using [KO Validated] RAB1B Rabbit pAb RAB1B Rabbit pAb (A7514) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Review
ABclonal: review for [KO Validated] RAB1B Rabbit pAb(A7514)

You may also interested in:

Overview

Product name [KO Validated] RAB1B Rabbit pAb
Catalog No. A7514
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Members of the RAB protein family, such as RAB1B, are low molecular mass monomeric GTPases localized on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB1B functions in the early secretory pathway and is essential for vesicle transport between the endoplasmic reticulum (ER) and Golgi (Chen et al., 1997 [PubMed 9030196]; Alvarez et al., 2003 [PubMed 12802079]).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 7-201 of human RAB1B (NP_112243.1).
Sequence YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC
Gene ID 81876
Swiss prot Q9H0U4
Synonyms RAB1B
Calculated MW 22kDa
Observed MW 22kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa
Cellular location Cytoplasm, Cytoplasmic side, Lipid-anchor, Membrane, Preautophagosomal structure membrane
Customer validation

WB (Human liver cancerMus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] RAB1B Rabbit pAb images

ABclonal:Western blot - [KO Validated] RAB1B Rabbit pAb (A7514)}

Western blot - [KO Validated] RAB1B Rabbit pAb (A7514)

Western blot analysis of lysates from wild type (WT) and RAB1B knockout (KO) HeLa cells using [KO Validated] RAB1B Rabbit pAb RAB1B Rabbit pAb (A7514) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Submit an review for A7514

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A7514 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RAB1B. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RAB1B. (Distance between topics and target gene indicate popularity.) RAB1B

* Data provided by citexs.com, for reference only.

Publishing research using A7514? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order