Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

RAB11FIP1 Rabbit pAb (A9215)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - RAB11FIP1 Rabbit pAb (A9215)

Western blot analysis of various lysates using RAB11FIP1 Rabbit pAb (A9215) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name RAB11FIP1 Rabbit pAb
Catalog No. A9215
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes one of the Rab11-family interacting proteins (Rab11-FIPs), which play a role in the Rab-11 mediated recycling of vesicles. The encoded protein may be involved in endocytic sorting, trafficking of proteins including integrin subunits and epidermal growth factor receptor (EGFR), and transport between the recycling endosome and the trans-Golgi network. Alternative splicing results in multiple transcript variants. A pseudogene is described on the X chromosome.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 330-540 of human RAB11FIP1 (NP_079427.4).
Sequence EAKGEIKDSSPSSSPSPKGFRKKHLFSSTENLAAGSWKEPAEGGGLSSDRQLSESSTKDSLKSMTLPSYRPAPLVSGDLRENMAPANSEATKEAKESKKPESRRSSLLSLMTGKKDVAKGSEGENPLTVPGREKEGMLMGVKPGEDASGPAEDLVRRSEKDTAAVVSRQGSSLNLFEDVQITEPEAEPESKSEPRPPISSPRAPQTRAVKP
Gene ID 80223
Swiss prot Q6WKZ4
Synonyms RCP; NOEL1A; rab11-FIP1; RAB11FIP1
Calculated MW 137kDa
Observed MW 80kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:200 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, HepG2, COS-7
Cellular location Cytoplasmic vesicle, Recycling endosome, phagosome membrane
Customer validation

WB (Homo sapiens)

IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

RAB11FIP1 Rabbit pAb images

ABclonal:Western blot - RAB11FIP1 Rabbit pAb (A9215)}

Western blot - RAB11FIP1 Rabbit pAb (A9215)

Western blot analysis of various lysates using RAB11FIP1 Rabbit pAb (A9215) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A9215 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RAB11FIP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RAB11FIP1. (Distance between topics and target gene indicate popularity.) RAB11FIP1

* Data provided by citexs.com, for reference only.

Publishing research using A9215? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order