Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

QPCT Rabbit pAb (A6711)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - QPCT Rabbit pAb (A6711)

Western blot analysis of various lysates, using QPCT Rabbit pAb (A6711) at 1:2500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - QPCT Rabbit pAb (A6711)

Immunofluorescence analysis of MCF-7 cells using QPCT antibody (A6711). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name QPCT Rabbit pAb
Catalog No. A6711
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes human pituitary glutaminyl cyclase, which is responsible for the presence of pyroglutamyl residues in many neuroendocrine peptides. The amino acid sequence of this enzyme is 86% identical to that of bovine glutaminyl cyclase.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-361 of human QPCT (NP_036545.1).
Sequence MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Gene ID 25797
Swiss prot Q16769
Synonyms QC; GCT; sQC; QPCT
Calculated MW 41kDa
Observed MW 41kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse liver, Rat liver
Cellular location Secreted
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

QPCT Rabbit pAb images

ABclonal:Western blot - QPCT Rabbit pAb (A6711)}

Western blot - QPCT Rabbit pAb (A6711)

Western blot analysis of various lysates, using QPCT Rabbit pAb (A6711) at 1:2500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - QPCT Rabbit pAb (A6711)}

Immunofluorescence - QPCT Rabbit pAb (A6711)

Immunofluorescence analysis of MCF-7 cells using QPCT antibody (A6711). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A6711 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on QPCT. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to QPCT. (Distance between topics and target gene indicate popularity.) QPCT

* Data provided by citexs.com, for reference only.

Publishing research using A6711? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order