Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PYGL Rabbit pAb (A6710)

Publications (3) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PYGL Rabbit pAb (A6710)

Western blot analysis of various lysates using PYGL Rabbit pAb (A6710) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - PYGL Rabbit pAb (A6710)

Immunohistochemistry analysis of PYGL in paraffin-embedded human liver using PYGL Rabbit pAb (A6710) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - PYGL Rabbit pAb (A6710)

Immunofluorescence analysis of HeLa cells using PYGL Rabbit pAb (A6710) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - PYGL Rabbit pAb (A6710)

Immunofluorescence analysis of HepG2 cells using PYGL Rabbit pAb (A6710) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - PYGL Rabbit pAb (A6710)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg PYGL antibody (A6710). Western blot was performed from the immunoprecipitate using PYGL antibody (A6710) at a dilution of 1:1000.

You may also interested in:

Overview

Product name PYGL Rabbit pAb
Catalog No. A6710
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a homodimeric protein that catalyses the cleavage of alpha-1, 4-glucosidic bonds to release glucose-1-phosphate from liver glycogen stores. This protein switches from inactive phosphorylase B to active phosphorylase A by phosphorylation of serine residue 15. Activity of this enzyme is further regulated by multiple allosteric effectors and hormonal controls. Humans have three glycogen phosphorylase genes that encode distinct isozymes that are primarily expressed in liver, brain and muscle, respectively. The liver isozyme serves the glycemic demands of the body in general while the brain and muscle isozymes supply just those tissues. In glycogen storage disease type VI, also known as Hers disease, mutations in liver glycogen phosphorylase inhibit the conversion of glycogen to glucose and results in moderate hypoglycemia, mild ketosis, growth retardation and hepatomegaly. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 690-847 of human PYGL (NP_002854.3).
Sequence IGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSNESNKVNGN
Gene ID 5836
Swiss prot P06737
Synonyms GSD6; PYGL
Calculated MW 97kDa
Observed MW 97kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples HeLa, HepG2, A-431, Mouse liver, Mouse kidney, Rat liver
Cellular location cytoplasm, cytosol, extracellular exosome, extracellular region
Customer validation

WB (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PYGL Rabbit pAb images

ABclonal:Western blot - PYGL Rabbit pAb (A6710)}

Western blot - PYGL Rabbit pAb (A6710)

Western blot analysis of various lysates using PYGL Rabbit pAb (A6710) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - PYGL Rabbit pAb (A6710)}

Immunohistochemistry - PYGL Rabbit pAb (A6710)

Immunohistochemistry analysis of PYGL in paraffin-embedded human liver using PYGL Rabbit pAb (A6710) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - PYGL Rabbit pAb (A6710)}

Immunofluorescence - PYGL Rabbit pAb (A6710)

Immunofluorescence analysis of HeLa cells using PYGL Rabbit pAb (A6710) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - PYGL Rabbit pAb (A6710)}

Immunofluorescence - PYGL Rabbit pAb (A6710)

Immunofluorescence analysis of HepG2 cells using PYGL Rabbit pAb (A6710) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - PYGL Rabbit pAb (A6710)}

Immunoprecipitation - PYGL Rabbit pAb (A6710)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg PYGL antibody (A6710). Western blot was performed from the immunoprecipitate using PYGL antibody (A6710) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A6710 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PYGL. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PYGL. (Distance between topics and target gene indicate popularity.) PYGL

* Data provided by citexs.com, for reference only.

Publishing research using A6710? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order