Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PWP2 Rabbit pAb (A5929)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - PWP2 Rabbit pAb (A5929)

Western blot analysis of extracts of various cell lines, using PWP2 antibody (A5929) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name PWP2 Rabbit pAb
Catalog No. A5929
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables RNA binding activity. Predicted to be involved in maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) and ribosomal small subunit assembly. Predicted to be located in nucleoplasm. Predicted to be part of Pwp2p-containing subcomplex of 90S preribosome and small-subunit processome.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 740-919 of human PWP2 (NP_005040.2).
Sequence ELDTSVTPGRVREALRQQDFTRAILMALRLNESKLVQEALEAVPRGEIEVVTSSLPELYVEKVLEFLASSFEVSRHLEFYLLWTHKLLMLHGQKLKSRAGTLLPVIQFLQKSIQRHLDDLSKLCSWNHYNMQYALAVSKQRGTKRSLDPLGSEEEAEASEDDSLHLLGGGGRDSEEEMLA
Gene ID 5822
Swiss prot Q15269
Synonyms UTP1; PWP2H; EHOC-17; PWP2
Calculated MW 102kDa
Observed MW 102kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:200 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, SH-SY5Y, NIH/3T3, K-562, Mouse thymus
Cellular location Nucleus, nucleolus

Research Area

PWP2 Rabbit pAb images

ABclonal:Western blot - PWP2 Rabbit pAb (A5929)}

Western blot - PWP2 Rabbit pAb (A5929)

Western blot analysis of extracts of various cell lines, using PWP2 antibody (A5929) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A5929 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PWP2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PWP2. (Distance between topics and target gene indicate popularity.) PWP2

* Data provided by citexs.com, for reference only.

Publishing research using A5929? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order