Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PTBP1 Rabbit pAb (A6107)

Publications (7) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PTBP1 Rabbit pAb (A6107)

Western blot analysis of HeLa, using PTBP1 antibody (A6107) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - PTBP1 Rabbit pAb (A6107)

Western blot analysis of various lysates, using PTBP1 Rabbit pAb (A6107) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - PTBP1 Rabbit pAb (A6107)

Immunohistochemistry analysis of paraffin-embedded human tonsil using PTBP1 antibody (A6107) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - PTBP1 Rabbit pAb (A6107)

Immunofluorescence analysis of U2OS cells using PTBP1 antibody (A6107) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name PTBP1 Rabbit pAb
Catalog No. A6107
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has four repeats of quasi-RNA recognition motif (RRM) domains that bind RNAs. This protein binds to the intronic polypyrimidine tracts that requires pre-mRNA splicing and acts via the protein degradation ubiquitin-proteasome pathway. It may also promote the binding of U2 snRNP to pre-mRNAs. This protein is localized in the nucleoplasm and it is also detected in the perinucleolar structure. Alternatively spliced transcript variants encoding different isoforms have been described.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PTBP1 (NP_114368.1).
Sequence MDGIVPDIAVGTKRGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIE
Gene ID 5725
Swiss prot P26599
Synonyms PTB; PTB2; PTB3; PTB4; pPTB; HNRPI; PTB-1; PTB-T; HNRNPI; HNRNP-I; PTBP1
Calculated MW 60kDa
Observed MW 59kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:100 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, NIH/3T3
Cellular location Nucleus
Customer validation

WB (Homo sapiens, Mus musculus)

IF (Mus musculus)

IHC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PTBP1 Rabbit pAb images

ABclonal:Western blot - PTBP1 Rabbit pAb (A6107)}

Western blot - PTBP1 Rabbit pAb (A6107)

Western blot analysis of HeLa, using PTBP1 antibody (A6107) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - PTBP1 Rabbit pAb (A6107)}

Western blot - PTBP1 Rabbit pAb (A6107)

Western blot analysis of various lysates, using PTBP1 Rabbit pAb (A6107) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - PTBP1 Rabbit pAb (A6107)}

Immunohistochemistry - PTBP1 Rabbit pAb (A6107)

Immunohistochemistry analysis of paraffin-embedded human tonsil using PTBP1 antibody (A6107) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - PTBP1 Rabbit pAb (A6107)}

Immunofluorescence - PTBP1 Rabbit pAb (A6107)

Immunofluorescence analysis of U2OS cells using PTBP1 antibody (A6107) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A6107 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PTBP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PTBP1. (Distance between topics and target gene indicate popularity.) PTBP1

* Data provided by citexs.com, for reference only.

Publishing research using A6107? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order