Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PEN2/PSENEN Rabbit pAb (A15172)

Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PEN2/PSENEN Rabbit pAb (A15172)

Western blot analysis of extracts of Mouse spleen, using PEN2/PSENEN antibody (A15172) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

You may also interested in:

Overview

Product name PEN2/PSENEN Rabbit pAb
Catalog No. A15172
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Presenilins, which are components of the gamma-secretase protein complex, are required for intramembranous processing of some type I transmembrane proteins, such as the Notch proteins and the beta-amyloid precursor protein. Signaling by Notch receptors mediates a wide range of developmental cell fates. Processing of the beta-amyloid precursor protein generates neurotoxic amyloid beta peptides, the major component of senile plaques associated with Alzheimer's disease. This gene encodes a protein that is required for Notch pathway signaling, and for the activity and accumulation of gamma-secretase. Mutations resulting in haploinsufficiency for this gene cause familial acne inversa-2 (ACNINV2). Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-101 of human PEN2/PSENEN (NP_758844.1).
Sequence MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP
Gene ID 55851
Swiss prot Q9NZ42
Synonyms PEN2; PEN-2; MDS033; ACNINV2; MSTP064; PEN2/PSENEN
Calculated MW 12kDa
Observed MW 13kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse spleen
Cellular location Endoplasmic reticulum membrane, Golgi apparatus, Golgi stack membrane, Multi-pass membrane protein
Customer validation

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PEN2/PSENEN Rabbit pAb images

ABclonal:Western blot - PEN2/PSENEN Rabbit pAb (A15172)}

Western blot - PEN2/PSENEN Rabbit pAb (A15172)

Western blot analysis of extracts of Mouse spleen, using PEN2/PSENEN antibody (A15172) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Inquire About This Product

Submit your question about A15172 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PSENEN. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PSENEN. (Distance between topics and target gene indicate popularity.) PSENEN

* Data provided by citexs.com, for reference only.

Publishing research using A15172? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order