Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Peroxiredoxin 6 Rabbit mAb (A4286)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Peroxiredoxin 6 Rabbit mAb (A4286)

Western blot analysis of extracts of various cell lines, using Peroxiredoxin 6 Rabbit mAb (A4286) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name Peroxiredoxin 6 Rabbit mAb
Catalog No. A4286
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0954

Background

The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 125-224 of human Peroxiredoxin 6 (NP_004896.1).
Sequence KGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
Gene ID 9588
Swiss prot P30041
Synonyms PRX; p29; AOP2; 1-Cys; NSGPx; aiPLA2; LPCAT-5; HEL-S-128m; Peroxiredoxin 6
Calculated MW 25kDa
Observed MW 25kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, 293T, Mouse liver, Mouse kidney, Rat lung, Rat liver, Rat kidney
Cellular location Cytoplasm, Cytoplasmic vesicle, Lysosome

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Peroxiredoxin 6 Rabbit mAb images

ABclonal:Western blot - Peroxiredoxin 6 Rabbit mAb (A4286)}

Western blot - Peroxiredoxin 6 Rabbit mAb (A4286)

Western blot analysis of extracts of various cell lines, using Peroxiredoxin 6 Rabbit mAb (A4286) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A4286 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PRDX6. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PRDX6. (Distance between topics and target gene indicate popularity.) PRDX6

* Data provided by citexs.com, for reference only.

Publishing research using A4286? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order