Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PRDM11 Rabbit pAb (A8502)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse

ABclonal:Western blot - PRDM11 Rabbit pAb (A8502)

Western blot analysis of extracts of various cell lines, using PRDM11 antibody (A8502) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

You may also interested in:

Overview

Product name PRDM11 Rabbit pAb
Catalog No. A8502
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable chromatin binding activity. Involved in several processes, including negative regulation of cell growth; positive regulation of fibroblast apoptotic process; and regulation of transcription, DNA-templated. Located in cytosol and nucleus.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 228-477 of human PRDM11 (NP_001243625.1).
Sequence DYMKRLHSMSQETIHRNLARGEKRLQREKSEQVLDNPEDLRGPIHLSVLRQGKSPYKRGFDEGDVHPQAKKKKIDLIFKDVLEASLESAKVEAHQLALSTSLVIRKVPKYQDDAYSQCATTMTHGVQNIGQTQGEGDWKVPQGVSKEPGQLEDEEEEPSSFKADSPAEASLASDPHELPTTSFCPNCIRLKKKVRELQAELDMLKSGKLPEPPVLPPQVLELPEFSDPAGKLVWMRLLSEGRVRSGLCGG
Gene ID 56981
Swiss prot Q9NQV5
Synonyms PFM8; PRDM11
Calculated MW 58kDa
Observed MW 58kDa

Applications

Reactivity Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse heart, Mouse lung
Cellular location Cytoplasm, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

PRDM11 Rabbit pAb images

ABclonal:Western blot - PRDM11 Rabbit pAb (A8502)}

Western blot - PRDM11 Rabbit pAb (A8502)

Western blot analysis of extracts of various cell lines, using PRDM11 antibody (A8502) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Inquire About This Product

Submit your question about A8502 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PRDM11. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PRDM11. (Distance between topics and target gene indicate popularity.) PRDM11

* Data provided by citexs.com, for reference only.

Publishing research using A8502? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order