Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PP2A-B56β/PR61β/PPP2R5B Rabbit pAb (A14252)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - PP2A-B56β/PR61β/PPP2R5B Rabbit pAb (A14252)

Western blot analysis of lysates from U-87MG cells, using PP2A-B56β/PR61β/PPP2R5B Rabbit pAb (A14252) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

You may also interested in:

Overview

Product name PP2A-B56β/PR61β/PPP2R5B Rabbit pAb
Catalog No. A14252
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a beta isoform of the regulatory subunit B56 subfamily.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PP2A-B56β/PR61β/PP2A-B56β/PR61β/PPP2R5B (NP_006235.1).
Sequence METKLPPASTPTSPSSPGLSPVPPPDKVDGFSRRSLRRARPRRSHSSSQFRYQSNQQELTPLPLLKDVPASELHELLSRKLAQCGVMFDFLDCVADLKGKEVKRAALNELVECVGSTRGVLIEPVYPDII
Gene ID 5526
Swiss prot Q15173
Synonyms B56B; PR61B; B56beta; PP2A-B56β/PR61β/PPP2R5B
Calculated MW 57kDa
Observed MW 57kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-87MG
Cellular location Cytoplasm

Research Area

PP2A-B56β/PR61β/PPP2R5B Rabbit pAb images

ABclonal:Western blot - PP2A-B56β/PR61β/PPP2R5B Rabbit pAb (A14252)}

Western blot - PP2A-B56β/PR61β/PPP2R5B Rabbit pAb (A14252)

Western blot analysis of lysates from U-87MG cells, using PP2A-B56β/PR61β/PPP2R5B Rabbit pAb (A14252) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Inquire About This Product

Submit your question about A14252 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PPP2R5B. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PPP2R5B. (Distance between topics and target gene indicate popularity.) PPP2R5B

* Data provided by citexs.com, for reference only.

Publishing research using A14252? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order