Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Ser/thr-PP2A activator (PTPA) Rabbit pAb (A11999)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Ser/thr-PP2A activator (PTPA) Rabbit pAb (A11999)

Western blot analysis of various lysates using Ser/thr-PP2A activator (PTPA) Rabbit pAb (A11999) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

You may also interested in:

Overview

Product name Ser/thr-PP2A activator (PTPA) Rabbit pAb
Catalog No. A11999
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B' family. This gene encodes a specific phosphotyrosyl phosphatase activator of the dimeric form of protein phosphatase 2A. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 58-240 of human Ser/thr-PP2A activator (PTPA) (NP_821068.1).
Sequence GVKGKKLTFEYRVSEMWNEVHEEKEQAAKQSVSCDECIPLPRAGHCAPSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAG
Gene ID 5524
Swiss prot Q15257
Synonyms PP2A; PR53; PPP2R4; Ser/thr-PP2A activator (PTPA)
Calculated MW 41kDa
Observed MW 40kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples LO2, K-562, U-87MG, MCF7, Mouse brain, Rat brain
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Ser/thr-PP2A activator (PTPA) Rabbit pAb images

ABclonal:Western blot - Ser/thr-PP2A activator (PTPA) Rabbit pAb (A11999)}

Western blot - Ser/thr-PP2A activator (PTPA) Rabbit pAb (A11999)

Western blot analysis of various lysates using Ser/thr-PP2A activator (PTPA) Rabbit pAb (A11999) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

Inquire About This Product

Submit your question about A11999 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PTPA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PTPA. (Distance between topics and target gene indicate popularity.) PTPA

* Data provided by citexs.com, for reference only.

Publishing research using A11999? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order