Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PP2A Catalytic β Rabbit pAb (A3122)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PP2A Catalytic β Rabbit pAb (A3122)

Western blot analysis of extracts of various cell lines, using PP2A Catalytic β antibody (A3122) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - PP2A Catalytic β Rabbit pAb (A3122)

Immunohistochemistry analysis of paraffin-embedded rat kidney using PP2A Catalytic β antibody (A3122) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PP2A Catalytic β Rabbit pAb (A3122)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using PP2A Catalytic β antibody (A3122) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PP2A Catalytic β Rabbit pAb (A3122)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using PP2A Catalytic β antibody (A3122) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - PP2A Catalytic β Rabbit pAb (A3122)

Immunofluorescence analysis of U-2 OS cells using PP2A Catalytic β antibody (A3122) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name PP2A Catalytic β Rabbit pAb
Catalog No. A3122
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes a beta isoform of the catalytic subunit.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-309 of human PP2A Catalytic β (NP_001009552.1).
Sequence MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Gene ID 5516
Swiss prot P62714
Synonyms PP2CB; PP2Abeta; PP2A Catalytic β
Calculated MW 36kDa
Observed MW 36kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:100 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples LO2, 293T, Mouse brain, Mouse lung, Mouse spleen, Rat liver
Cellular location Chromosome, Cytoplasm, Nucleus, centromere, cytoskeleton, spindle pole
Customer validation

IF (Homo sapiens)

ChIP (Homo sapiens)

DB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PP2A Catalytic β Rabbit pAb images

ABclonal:Western blot - PP2A Catalytic β Rabbit pAb (A3122)}

Western blot - PP2A Catalytic β Rabbit pAb (A3122)

Western blot analysis of extracts of various cell lines, using PP2A Catalytic β antibody (A3122) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - PP2A Catalytic β Rabbit pAb (A3122)}

Immunohistochemistry - PP2A Catalytic β Rabbit pAb (A3122)

Immunohistochemistry analysis of paraffin-embedded rat kidney using PP2A Catalytic β antibody (A3122) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PP2A Catalytic β Rabbit pAb (A3122)}

Immunohistochemistry - PP2A Catalytic β Rabbit pAb (A3122)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using PP2A Catalytic β antibody (A3122) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PP2A Catalytic β Rabbit pAb (A3122)}

Immunohistochemistry - PP2A Catalytic β Rabbit pAb (A3122)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using PP2A Catalytic β antibody (A3122) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - PP2A Catalytic β Rabbit pAb (A3122)}

Immunofluorescence - PP2A Catalytic β Rabbit pAb (A3122)

Immunofluorescence analysis of U-2 OS cells using PP2A Catalytic β antibody (A3122) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A3122 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PPP2CB. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PPP2CB. (Distance between topics and target gene indicate popularity.) PPP2CB

* Data provided by citexs.com, for reference only.

Publishing research using A3122? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order