Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PPP1R13L Rabbit pAb (A10462)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - PPP1R13L Rabbit pAb (A10462)

Western blot analysis of extracts of various cell lines, using PPP1R13L antibody (A10462) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name PPP1R13L Rabbit pAb
Catalog No. A10462
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

IASPP is one of the most evolutionarily conserved inhibitors of p53 (TP53; MIM 191170), whereas ASPP1 (MIM 606455) and ASPP2 (MIM 602143) are activators of p53.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 589-828 of human PPP1R13L (NP_006654.2).
Sequence PPPAPSQSSPPEQPQSMEMRSVLRKAGSPRKARRARLNPLVLLLDAALTGELEVVQQAVKEMNDPSQPNEEGITALHNAICGANYSIVDFLITAGANVNSPDSHGWTPLHCAASCNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDELSFREGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQRSKV
Gene ID 10848
Swiss prot Q8WUF5
Synonyms RAI; RAI4; IASPP; NKIP1; PPP1R13L
Calculated MW 89kDa
Observed MW 105kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples LO2, SW480, U-87MG
Cellular location Cytoplasm, Nucleus

Research Area

PPP1R13L Rabbit pAb images

ABclonal:Western blot - PPP1R13L Rabbit pAb (A10462)}

Western blot - PPP1R13L Rabbit pAb (A10462)

Western blot analysis of extracts of various cell lines, using PPP1R13L antibody (A10462) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A10462 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PPP1R13L. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PPP1R13L. (Distance between topics and target gene indicate popularity.) PPP1R13L

* Data provided by citexs.com, for reference only.

Publishing research using A10462? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order