Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

POMGNT2 Rabbit pAb (A14518)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - POMGNT2 Rabbit pAb (A14518)

Western blot analysis of various lysates using POMGNT2 Rabbit pAb (A14518) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

You may also interested in:

Overview

Product name POMGNT2 Rabbit pAb
Catalog No. A14518
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein with glycosyltransferase activity although its function is not currently known.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 160-340 of human POMGNT2 (NP_116195.2).
Sequence NPDNLMHVFHDDLLPLFYTLRQFPGLAHEARLFFMEGWGEGAHFDLYKLLSPKQPLLRAQLKTLGRLLCFSHAFVGLSKITTWYQYGFVQPQGPKANILVSGNEIRQFARFMTEKLNVSHTGVPLGEEYILVFSRTQNRLILNEAELLLALAQEFQMKTVTVSLEDHTFADVVRLVSNASM
Gene ID 84892
Swiss prot Q8NAT1
Synonyms AGO61; GTDC2; MDDGA8; MDDGC8; C3orf39; POMGNT2
Calculated MW 67kDa
Observed MW 75kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples SH-SY5Y, 293T, BxPC-3, A-549, Mouse ovary, Mouse brain, Mouse pancreas, Rat brain
Cellular location Endoplasmic reticulum membrane, Single-pass type II membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

POMGNT2 Rabbit pAb images

ABclonal:Western blot - POMGNT2 Rabbit pAb (A14518)}

Western blot - POMGNT2 Rabbit pAb (A14518)

Western blot analysis of various lysates using POMGNT2 Rabbit pAb (A14518) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Inquire About This Product

Submit your question about A14518 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on POMGNT2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to POMGNT2. (Distance between topics and target gene indicate popularity.) POMGNT2

* Data provided by citexs.com, for reference only.

Publishing research using A14518? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order