Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

POLR3A Rabbit pAb (A10737)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - POLR3A Rabbit pAb (A10737)

Western blot analysis of lysates from 293T cells, using POLR3A Rabbit pAb (A10737) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

You may also interested in:

Overview

Product name POLR3A Rabbit pAb
Catalog No. A10737
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is the catalytic component of RNA polymerase III, which synthesizes small RNAs. The encoded protein also acts as a sensor to detect foreign DNA and trigger an innate immune response.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human POLR3A (NP_008986.2).
Sequence MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNQHAPLLYGVLDHRMGTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQEEKKQFLDYLKRPGLTYLQKRGLKKKISDKCRKKNICHHCGAFNGTVKKCGLLKIIHEKYKTNKKVVDPIVSNFLQSFETA
Gene ID 11128
Swiss prot O14802
Synonyms ADDH; C160; HLD7; RPC1; WDRTS; RPC155; hRPC155; POLR3A
Calculated MW 156kDa
Observed MW 156kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T
Cellular location Nucleus

POLR3A Rabbit pAb images

ABclonal:Western blot - POLR3A Rabbit pAb (A10737)}

Western blot - POLR3A Rabbit pAb (A10737)

Western blot analysis of lysates from 293T cells, using POLR3A Rabbit pAb (A10737) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Inquire About This Product

Submit your question about A10737 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on POLR3A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to POLR3A. (Distance between topics and target gene indicate popularity.) POLR3A

* Data provided by citexs.com, for reference only.

Publishing research using A10737? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order