Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PNLIP Rabbit pAb (A7421)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - PNLIP Rabbit pAb (A7421)

Western blot analysis of extracts of BxPC-3 cells, using PNLIP antibody (A7421) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 15s.

ABclonal:Immunohistochemistry - PNLIP Rabbit pAb (A7421)

Immunohistochemistry analysis of paraffin-embedded human liver cancer using PNLIP antibody (A7421) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - PNLIP Rabbit pAb (A7421)

Immunofluorescence analysis of U2OS cells using PNLIP antibody (A7421). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name PNLIP Rabbit pAb
Catalog No. A7421
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the lipase family of proteins. The encoded enzyme is secreted by the pancreas and hydrolyzes triglycerides in the small intestine, and is essential for the efficient digestion of dietary fats. Inhibition of the encoded enzyme may prevent high-fat diet-induced obesity in mice and result in weight loss in human patients with obesity. Mutations in this gene cause congenital pancreatic lipase deficiency, a rare disorder characterized by steatorrhea.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 166-465 of human PNLIP (NP_000927.1).
Sequence IGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWYNNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC
Gene ID 5406
Swiss prot P16233
Synonyms PL; PTL; PNLIPD; PNLIP
Calculated MW 51kDa
Observed MW 51kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples BxPC-3
Cellular location Secreted

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PNLIP Rabbit pAb images

ABclonal:Western blot - PNLIP Rabbit pAb (A7421)}

Western blot - PNLIP Rabbit pAb (A7421)

Western blot analysis of extracts of BxPC-3 cells, using PNLIP antibody (A7421) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 15s.
ABclonal:Immunohistochemistry - PNLIP Rabbit pAb (A7421)}

Immunohistochemistry - PNLIP Rabbit pAb (A7421)

Immunohistochemistry analysis of paraffin-embedded human liver cancer using PNLIP antibody (A7421) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - PNLIP Rabbit pAb (A7421)}

Immunofluorescence - PNLIP Rabbit pAb (A7421)

Immunofluorescence analysis of U2OS cells using PNLIP antibody (A7421). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A7421 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PNLIP. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PNLIP. (Distance between topics and target gene indicate popularity.) PNLIP

* Data provided by citexs.com, for reference only.

Publishing research using A7421? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order