Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PMS1 Rabbit pAb (A14046)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - PMS1 Rabbit pAb (A14046)

Western blot analysis of extracts of various cell lines, using PMS1 antibody (A14046) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

You may also interested in:

Overview

Product name PMS1 Rabbit pAb
Catalog No. A14046
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein belonging to the DNA mismatch repair mutL/hexB family. This protein is thought to be involved in the repair of DNA mismatches, and it can form heterodimers with MLH1, a known DNA mismatch repair protein. Mutations in this gene cause hereditary nonpolyposis colorectal cancer type 3 (HNPCC3) either alone or in combination with mutations in other genes involved in the HNPCC phenotype, which is also known as Lynch syndrome.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 405-619 of human PMS1 (NP_000525.1).
Sequence DCLNHQISIGDFGYGHCSSEISNIDKNTKNAFQDISMSNVSWENSQTEYSKTCFISSVKHTQSENGNKDHIDESGENEEEAGLENSSEISADEWSRGNILKNSVGENIEPVKILVPEKSLPCKVSNNNYPIPEQMNLNEDSCNKKSNVIDNKSGKVTAYDLLSNRVIKKPMSASALFVQDHRPQFLIENPKTSLEDATLQIEELWKTLSEEEKLK
Gene ID 5378
Swiss prot P54277
Synonyms MLH2; PMSL1; hPMS1; HNPCC3; PMS1
Calculated MW 106kDa
Observed MW 110kDa

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse liver, Mouse spleen, Rat brain
Cellular location Nucleus

Research Area

PMS1 Rabbit pAb images

ABclonal:Western blot - PMS1 Rabbit pAb (A14046)}

Western blot - PMS1 Rabbit pAb (A14046)

Western blot analysis of extracts of various cell lines, using PMS1 antibody (A14046) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Inquire About This Product

Submit your question about A14046 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PMS1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PMS1. (Distance between topics and target gene indicate popularity.) PMS1

* Data provided by citexs.com, for reference only.

Publishing research using A14046? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order