Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PMP2 Rabbit pAb (A8851)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse

ABclonal:Western blot - PMP2 Rabbit pAb (A8851)

Western blot analysis of extracts of mouse small intestine, using PMP2 antibody (A8851) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

You may also interested in:

Overview

Product name PMP2 Rabbit pAb
Catalog No. A8851
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene localizes to myelin sheaths of the peripheral nervous system. The encoded protein can bind both the membrane layers of the sheaths and monomeric lipids, and is thought to provide stability to the sheath. A defect in this gene was shown to be a cause of dominant demyelinating CMT neuropathy.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-132 of human PMP2 (NP_002668.1).
Sequence MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
Gene ID 5375
Swiss prot P02689
Synonyms P2; MP2; CMT1G; FABP8; M-FABP; PMP2
Calculated MW 15kDa
Observed MW 15kDa

Applications

Reactivity Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse small intestine
Cellular location Cytoplasm

Research Area

PMP2 Rabbit pAb images

ABclonal:Western blot - PMP2 Rabbit pAb (A8851)}

Western blot - PMP2 Rabbit pAb (A8851)

Western blot analysis of extracts of mouse small intestine, using PMP2 antibody (A8851) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Inquire About This Product

Submit your question about A8851 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PMP2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PMP2. (Distance between topics and target gene indicate popularity.) PMP2

* Data provided by citexs.com, for reference only.

Publishing research using A8851? Please let us know so that we can cite the reference in this datasheet.

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order