Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PLS1 Rabbit pAb (A15303)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PLS1 Rabbit pAb (A15303)

Western blot analysis of various lysates using PLS1 Rabbit pAb (A15303) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - PLS1 Rabbit pAb (A15303)

Immunohistochemistry analysis of PLS1 in paraffin-embedded rat kidney using PLS1 Rabbit pAb (A15303) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PLS1 Rabbit pAb (A15303)

Immunohistochemistry analysis of PLS1 in paraffin-embedded mouse kidney using PLS1 Rabbit pAb (A15303) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name PLS1 Rabbit pAb
Catalog No. A15303
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The protein encoded by this gene is a third distinct plastin isoform, which is specifically expressed at high levels in the small intestine. Alternatively spliced transcript variants varying in the 5' UTR, but encoding the same protein, have been found for this gene. A pseudogene of this gene is found on chromosome 11.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human PLS1 (NP_001165783.1).
Sequence MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKILSVADSNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTST
Gene ID 5357
Swiss prot Q14651
Synonyms DFNA76; PLS1
Calculated MW 70kDa
Observed MW 70kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:200 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HT-29, 293T, LO2, Mouse brain, Mouse liver, Rat spleen
Cellular location Cytoplasm

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PLS1 Rabbit pAb images

ABclonal:Western blot - PLS1 Rabbit pAb (A15303)}

Western blot - PLS1 Rabbit pAb (A15303)

Western blot analysis of various lysates using PLS1 Rabbit pAb (A15303) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
ABclonal:Immunohistochemistry - PLS1 Rabbit pAb (A15303)}

Immunohistochemistry - PLS1 Rabbit pAb (A15303)

Immunohistochemistry analysis of PLS1 in paraffin-embedded rat kidney using PLS1 Rabbit pAb (A15303) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PLS1 Rabbit pAb (A15303)}

Immunohistochemistry - PLS1 Rabbit pAb (A15303)

Immunohistochemistry analysis of PLS1 in paraffin-embedded mouse kidney using PLS1 Rabbit pAb (A15303) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A15303 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PLS1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PLS1. (Distance between topics and target gene indicate popularity.) PLS1

* Data provided by citexs.com, for reference only.

Publishing research using A15303? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order