Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PLOD2/LH2 Rabbit pAb (A6946)

Reviews (6) Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PLOD2/LH2 Rabbit pAb (A6946)

Western blot analysis of extracts of various cell lines, using PLOD2/LH2 antibody (A6946) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Western blot - PLOD2/LH2 Rabbit pAb (A6946)

Western blot analysis of extracts of Rat uterus, using PLOD2/LH2 antibody (A6946) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Western blot - PLOD2/LH2 Rabbit pAb (A6946)

Western blot analysis of extracts of Mouse uterus, using PLOD2/LH2 antibody (A6946) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Review
ABclonal: review for PLOD2/LH2 Rabbit pAb(A6946)
Review
ABclonal: review for PLOD2/LH2 Rabbit pAb(A6946)
Review
ABclonal: review for PLOD2/LH2 Rabbit pAb(A6946)
Review
ABclonal: review for PLOD2/LH2 Rabbit pAb(A6946)
Review
ABclonal: review for PLOD2/LH2 Rabbit pAb(A6946)
Review
ABclonal: review for PLOD2/LH2 Rabbit pAb(A6946)

You may also interested in:

Overview

Product name PLOD2/LH2 Rabbit pAb
Catalog No. A6946
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a membrane-bound homodimeric enzyme that is localized to the cisternae of the rough endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptides. The resultant hydroxylysyl groups are attachment sites for carbohydrates in collagen and thus are critical for the stability of intermolecular crosslinks. Some patients with Ehlers-Danlos syndrome type VIB have deficiencies in lysyl hydroxylase activity. Mutations in the coding region of this gene are associated with Bruck syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 260-380 of human PLOD2/LH2 (NP_000926.2).
Sequence ILLNYFGNYVPNSWTQDNGCTLCEFDTVDLSAVDVHPNVSIGVFIEQPTPFLPRFLDILLTLDYPKEALKLFIHNKEVYHEKDIKVFFDKAKHEIKTIKIVGPEENLSQAEARNMGMDFCR
Gene ID 5352
Swiss prot O00469
Synonyms LH2; TLH; BRKS2; PLOD2/LH2
Calculated MW 85kDa
Observed MW 100kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples DU145, U-87MG, Molt-4, Mouse uterus, Rat uterus
Cellular location Lumenal side, Peripheral membrane protein, Rough endoplasmic reticulum membrane
Customer validation

IF (Human fibrosarcoma cell line, 3T3-L1Rattus norvegicus)

WB (Human fibrosarcoma cells, 3T3-L1, H1975Homo sapiens, Homo sapiens, Chlorocebus sabaeus, Rattus norvegicus)

IHC (MDA-MB-231)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PLOD2/LH2 Rabbit pAb images

ABclonal:Western blot - PLOD2/LH2 Rabbit pAb (A6946)}

Western blot - PLOD2/LH2 Rabbit pAb (A6946)

Western blot analysis of extracts of various cell lines, using PLOD2/LH2 antibody (A6946) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
ABclonal:Western blot - PLOD2/LH2 Rabbit pAb (A6946)}

Western blot - PLOD2/LH2 Rabbit pAb (A6946)

Western blot analysis of extracts of Rat uterus, using PLOD2/LH2 antibody (A6946) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Western blot - PLOD2/LH2 Rabbit pAb (A6946)}

Western blot - PLOD2/LH2 Rabbit pAb (A6946)

Western blot analysis of extracts of Mouse uterus, using PLOD2/LH2 antibody (A6946) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Submit an review for A6946

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A6946 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PLOD2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PLOD2. (Distance between topics and target gene indicate popularity.) PLOD2

* Data provided by citexs.com, for reference only.

Publishing research using A6946? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order