Reviews (6) Publications (4) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | PLOD2/LH2 Rabbit pAb |
---|---|
Catalog No. | A6946 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 260-380 of human PLOD2/LH2 (NP_000926.2). |
---|---|
Sequence | ILLNYFGNYVPNSWTQDNGCTLCEFDTVDLSAVDVHPNVSIGVFIEQPTPFLPRFLDILLTLDYPKEALKLFIHNKEVYHEKDIKVFFDKAKHEIKTIKIVGPEENLSQAEARNMGMDFCR |
Gene ID | 5352 |
Swiss prot | O00469 |
Synonyms | LH2; TLH; BRKS2; PLOD2/LH2 |
Calculated MW | 85kDa |
Observed MW | 100kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | DU145, U-87MG, Molt-4, Mouse uterus, Rat uterus |
Cellular location | Lumenal side, Peripheral membrane protein, Rough endoplasmic reticulum membrane |
Customer validation | IF (Human fibrosarcoma cell line, 3T3-L1Rattus norvegicus) WB (Human fibrosarcoma cells, 3T3-L1, H1975Homo sapiens, Homo sapiens, Chlorocebus sabaeus, Rattus norvegicus) IHC (MDA-MB-231) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A6946 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on PLOD2. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to PLOD2. (Distance between topics and target gene indicate popularity.) PLOD2
* Data provided by citexs.com, for reference only.
Publishing research using A6946? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.