Publications (2) Datasheet COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Mouse, Rat
Product name | PI3 Kinase p85 alpha Rabbit pAb |
---|---|
Catalog No. | A11402 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 240-380 of human PI3 Kinase p85 alpha (NP_852556.2). |
---|---|
Sequence | EKFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRE |
Gene ID | 5295 |
Swiss prot | P27986 |
Synonyms | p85; AGM7; GRB1; IMD36; p85alpha; p85-ALPHA; PI3 Kinase p85 alpha |
Calculated MW | 84kDa |
Observed MW | 85kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Application key | Western blotting Immunofluorescence |
Positive samples | Mouse brain, Mouse liver, Rat brain, Rat liver |
Cellular location | cell-cell junction, cis-Golgi network, cytoplasm, cytosol, nucleus, perinuclear region of cytoplasm, plasma membrane |
Customer validation | WB (Mus musculus, Gallus gallus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A11402 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on PIK3R1. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to PIK3R1. (Distance between topics and target gene indicate popularity.) PIK3R1
* Data provided by citexs.com, for reference only.
Publishing research using A11402? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.