Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PI3 Kinase p85 alpha Rabbit pAb (A11177)

Reviews (3) Publications (9) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PI3 Kinase p85 alpha Rabbit pAb (A11177)

Western blot analysis of various lysates, using PI3 Kinase p85 alpha Rabbit pAb (A11177) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - PI3 Kinase p85 alpha Rabbit pAb (A11177)

Immunofluorescence analysis of NIH/3T3 cells using PI3 Kinase p85 alpha Rabbit pAb (A11177) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - PI3 Kinase p85 alpha Rabbit pAb (A11177)

Immunofluorescence analysis of PC-12 cells using PI3 Kinase p85 alpha Rabbit pAb (A11177) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for PI3 Kinase p85 alpha Rabbit pAb(A11177)
Review
ABclonal: review for PI3 Kinase p85 alpha Rabbit pAb(A11177)
Review
ABclonal: review for PI3 Kinase p85 alpha Rabbit pAb(A11177)

You may also interested in:

Overview

Product name PI3 Kinase p85 alpha Rabbit pAb
Catalog No. A11177
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Phosphatidylinositol 3-kinase phosphorylates the inositol ring of phosphatidylinositol at the 3-prime position. The enzyme comprises a 110 kD catalytic subunit and a regulatory subunit of either 85, 55, or 50 kD. This gene encodes the 85 kD regulatory subunit. Phosphatidylinositol 3-kinase plays an important role in the metabolic actions of insulin, and a mutation in this gene has been associated with insulin resistance. Alternative splicing of this gene results in four transcript variants encoding different isoforms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 240-380 of human PI3 Kinase p85 alpha (NP_852664.1).
Sequence LQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKL
Gene ID 5295
Swiss prot P27986
Synonyms p85; AGM7; GRB1; IMD36; p85alpha; p85-ALPHA; PI3 Kinase p85 alpha
Calculated MW 84kDa
Observed MW 85kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Jurkat, 293F, NIH/3T3
Cellular location cell-cell junction, cis-Golgi network, cytoplasm, cytosol, nucleus, perinuclear region of cytoplasm, plasma membrane
Customer validation

WB (Human chronic myeloid leukemia cellsHomo sapiens, Homo sapiens, Mus musculus, Rattus norvegicus)

IF (Human chronic myeloid leukemia cells)

IHC (Human chronic myeloid leukemia cellsRattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PI3 Kinase p85 alpha Rabbit pAb images

ABclonal:Western blot - PI3 Kinase p85 alpha Rabbit pAb (A11177)}

Western blot - PI3 Kinase p85 alpha Rabbit pAb (A11177)

Western blot analysis of various lysates, using PI3 Kinase p85 alpha Rabbit pAb (A11177) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - PI3 Kinase p85 alpha Rabbit pAb (A11177)}

Immunofluorescence - PI3 Kinase p85 alpha Rabbit pAb (A11177)

Immunofluorescence analysis of NIH/3T3 cells using PI3 Kinase p85 alpha Rabbit pAb (A11177) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - PI3 Kinase p85 alpha Rabbit pAb (A11177)}

Immunofluorescence - PI3 Kinase p85 alpha Rabbit pAb (A11177)

Immunofluorescence analysis of PC-12 cells using PI3 Kinase p85 alpha Rabbit pAb (A11177) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A11177

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A11177 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PIK3R1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PIK3R1. (Distance between topics and target gene indicate popularity.) PIK3R1

* Data provided by citexs.com, for reference only.

Publishing research using A11177? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order